Recombinant Sheep Neuropeptide Y receptor type 2 (NPY2R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NPY2R; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
Full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
KMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVS ALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKGIYGTVYSLLSLLILYVLPLGIIS FSYARIWSKLKNHVSPGAAHDHYHQR
Uniprot No.

Target Background

Function
Receptor for neuropeptide Y and peptide YY.
Database Links

UniGene: Oar.523

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Sheep Neuropeptide Y receptor type 2 (NPY2R)?

Recombinant Sheep NPY2R is a laboratory-produced version of the natural Neuropeptide Y receptor type 2 protein found in sheep. It belongs to the class of G-protein coupled receptors that are activated by closely related peptide hormones including neuropeptide Y, peptide YY, and pancreatic polypeptide. The recombinant protein typically consists of the full-length sequence (1-146 amino acids) and can be expressed with various tags (commonly His-tag) to facilitate purification and experimental applications . NPY receptors, including NPY2R, are involved in regulating several critical behavioral and physiological processes including appetite control, circadian rhythm maintenance, and anxiety modulation .

What expression systems are commonly used for Recombinant Sheep NPY2R production?

Escherichia coli (E. coli) is the most commonly documented expression system for recombinant Sheep NPY2R production . This prokaryotic expression system offers advantages including:

Expression SystemAdvantagesLimitationsYield Potential
E. coli- Rapid growth
- Cost-effective
- High protein yields
- Well-established protocols
- Limited post-translational modifications
- Potential for inclusion body formation
- Potential endotoxin contamination
High (can exceed >90% purity after affinity chromatography)

For functional studies requiring proper folding and post-translational modifications, researchers sometimes opt for eukaryotic expression systems like yeast, insect cells, or mammalian cells, though these alternatives typically result in lower yields but potentially higher biological activity.

How should Recombinant Sheep NPY2R be reconstituted for optimal activity?

For optimal reconstitution of lyophilized Recombinant Sheep NPY2R:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (commonly 50%)

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week, and long-term storage at -20°C/-80°C

This protocol helps maintain protein integrity and activity by minimizing denaturation that can occur during repeated freeze-thaw cycles.

What methodologies are most effective for studying NPY2R binding characteristics?

Autoradiographic binding methodology represents one of the most effective approaches for studying NPY2R binding characteristics. This technique typically employs:

  • Monoiodinated peptide YY (125I-PYY) as the primary ligand

  • Competition with NPY (1-36) and NPY (13-36) to assess binding specificity

  • Quantitative measurement of binding in various tissue regions

In experimental settings, approximately 95% of specific binding sites can be displaced by the full-length peptide NPY (1-36) at 10−6M concentration, while approximately 90% can be displaced by the Y2 receptor-specific ligand NPY (13-36) at the same concentration . This displacement pattern confirms Y2 receptor subtype specificity.

For studying NPY2R expression at the mRNA level, in situ hybridization using oligonucleotide probes complementary to Y2-R mRNA provides valuable information about receptor distribution and regulation .

How does NPY2R expression and binding change under pathological conditions?

Studies in mouse models of prion disease have demonstrated significant alterations in NPY2R binding under pathological conditions. These changes include:

Brain RegionTime Point Post-Prion InoculationChange in 125I-PYY BindingChange in Y2-R mRNA
CA1 strata oriens and radiatum110-140 days↓ 85%No significant change
CA3 stratum oriens110-140 days↓ 50-65%↓ ~20% (significant only at 130 days)
CA3 stratum radiatum110-120 daysSignificant decreaseNot significant
Dentate gyrus110-140 daysNot reported↓ ~20% (not statistically significant)
Hypothalamus110-140 daysNo changeNot reported

These findings indicate that pathological accumulation of prion proteins can dramatically decrease NPY binding capacity at Y2-Rs, particularly in hippocampal regions, while only marginally affecting Y2-R mRNA expression . This suggests that post-transcriptional mechanisms likely play a significant role in the pathological regulation of NPY2R function.

What is the significance of NPY2R in neurological function and disease models?

NPY2R plays a crucial role in modulating neurological functions, particularly in the hippocampus. Research indicates that:

  • NPY2Rs are predominantly expressed in pyramidal cell layers of CA1-3 regions and granule cell layer of the dentate gyrus

  • These receptors function presynaptically to inhibit glutamate release at the Schaffer collateral-CA1 synapses

  • Under pathological conditions (e.g., prion disease), decreased Y2-R binding in the CA1 stratum radiatum may attenuate NPY-mediated inhibition

The dysregulation of NPY2R has been implicated in various neurological conditions:

  • In mouse scrapie (prion disease), CA3 pyramidal neurons show increased NPY mRNA expression while Y2-R binding decreases

  • Similar changes in NPY system plasticity occur in various forms of hippocampal pathology, including seizure activity and epilepsy

  • These alterations may represent compensatory mechanisms to protect neurons against glutamate-induced excitotoxicity

Understanding these mechanisms provides valuable insights for developing therapeutic strategies targeting NPY2R in neurological disorders.

What techniques are recommended for studying NPY2R signaling pathways?

For comprehensive investigation of NPY2R signaling pathways, researchers should consider a multi-modal approach:

  • Receptor Binding Assays:

    • Autoradiography with 125I-PYY to quantify binding site density

    • Competition binding with NPY (1-36) and NPY (13-36) to confirm Y2 receptor specificity

  • Gene Expression Analysis:

    • In situ hybridization to localize Y2-R mRNA in specific cell populations

    • qRT-PCR for quantitative assessment of mRNA levels

  • Functional Studies:

    • Electrophysiological recordings to assess effects on neurotransmitter release

    • Calcium imaging to monitor intracellular signaling

    • cAMP assays to measure G-protein coupled receptor activity

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify binding partners

    • Proximity ligation assays to verify interactions in situ

These methodologies, when used in combination, provide a comprehensive understanding of NPY2R signaling in both physiological and pathological contexts.

How can researchers validate the specificity of antibodies against Sheep NPY2R?

Validating antibody specificity for Sheep NPY2R requires a systematic approach:

  • Western Blot Analysis:

    • Use purified recombinant Sheep NPY2R protein as a positive control

    • Include negative controls (irrelevant protein, blocking peptide competition)

    • Confirm the expected molecular weight (~146 amino acids plus tag size)

  • Immunocytochemistry/Immunohistochemistry:

    • Compare staining patterns with published NPY2R distribution data

    • Perform blocking peptide competition to confirm specificity

    • Include negative controls (primary antibody omission, irrelevant primary antibody)

  • Cross-Reactivity Testing:

    • Assess reactivity against human and rat NPY2R due to potential species cross-reactivity

    • Note that antibody reactivity and working conditions may vary between species

  • Functional Validation:

    • Confirm that the antibody blocks or modulates known NPY2R-mediated responses

    • Test the antibody's ability to immunoprecipitate functional NPY2R

What are common challenges in working with Recombinant Sheep NPY2R and how can they be addressed?

ChallengeCauseSolution
Protein InsolubilityHydrophobic transmembrane domains- Use appropriate detergents (e.g., CHAPS, DDM)
- Consider protein refolding from inclusion bodies
- Express soluble fragments or fusion constructs
Loss of ActivityImproper folding or denaturation- Optimize storage conditions (add glycerol, avoid freeze-thaw)
- Reconstitute in appropriate buffers (Tris/PBS-based, pH 8.0)
- Consider native purification methods
Low Expression YieldsCodon bias, toxicity to host- Optimize codon usage for expression host
- Use inducible expression systems
- Consider alternative expression hosts
Poor Binding AffinityIncorrect folding, missing modifications- Validate with functional assays
- Compare with native receptor properties
- Consider eukaryotic expression systems
Antibody Cross-ReactivitySequence homology between species- Use peptide competition assays
- Validate across multiple techniques
- Design species-specific antibodies

How might Recombinant Sheep NPY2R contribute to neurodegenerative disease research?

The observed changes in NPY2R binding in prion disease models suggest several promising research directions:

  • Biomarker Development: The dramatic decrease in Y2-R binding in specific hippocampal regions during prion disease progression suggests potential for developing imaging or biochemical biomarkers for early detection of neurodegenerative processes.

  • Neuroprotective Strategies: Understanding the upregulation of NPY in CA3 pyramidal cells and its potential neuroprotective role against glutamate excitotoxicity could inform development of NPY2R-targeted therapies.

  • Circuit-Specific Interventions: The region-specific changes in NPY2R binding (e.g., 85% reduction in CA1 vs. 50-65% in CA3) highlight the importance of circuit-specific approaches to therapeutic intervention.

  • Synaptic Dysfunction Mechanisms: Investigating how decreased Y2-R binding affects glutamatergic transmission at Schaffer collateral-CA1 synapses may reveal fundamental mechanisms of synaptic dysfunction in neurodegenerative diseases.

  • Comparative Neurobiology: Studying Sheep NPY2R alongside human NPY2R could provide insights into conserved pathways relevant to human diseases while leveraging advantages of ruminant models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.