Recombinant Sheep Oxytocin receptor (OXTR)

Shipped with Ice Packs
In Stock

Description

Binding Dynamics

Recombinant OXTR retains native ligand-binding properties. Studies using similar recombinant systems show oxytocin binds OXTR with equilibrium dissociation constants (K<sub>d</sub>) ranging from 0.56 nM to 9.32 nM, depending on cell type and species . In sheep myometrial cells, OXTR expression peaks during late pregnancy, facilitating uterine contractions via phospholipase C (PLC) and MAP kinase pathways .

Genetic Variants

While sheep-specific OXTR variants are less studied, human OXTR mutants (e.g., V281M and E339K) exhibit reduced surface localization and signaling. Recombinant systems enable testing of dose-response relationships; simulations suggest 2.5-fold oxytocin increases can transiently rescue mutant receptor activity .

Research Applications

  • Binding Assays: Used to quantify oxytocin affinity and antagonist effects .

  • Structural Studies: Facilitates crystallography and membrane protein dynamics analysis .

  • Signal Transduction: Models GPCR-mediated pathways, including calcium mobilization and RhoA/ROK activation .

Comparative Analysis

Sheep OXTR shares 85–90% homology with human and bovine receptors, particularly in transmembrane domains critical for G<sub>q/11</sub> coupling . Key differences in the C-terminal tail may influence species-specific signaling outcomes.

Technical Considerations

  • Limitations: Lack of post-translational modifications in E. coli-expressed OXTR may affect ligand-binding kinetics compared to mammalian cell systems .

  • Validation: Requires functional assays (e.g., GTPγS binding) to confirm receptor activity .

This recombinant tool bridges gaps in understanding OXTR's role in parturition, lactation, and social behavior, offering a controlled platform for pharmacological and genetic studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on your location and the purchasing method. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please contact us in advance for an additional fee.
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Repeated freeze-thaw cycles should be minimized.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
OXTR; Oxytocin receptor; OT-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MEGAFAANWSAEAVNGSAAPPGTEGNRTAGPPQRNEALARVEVAVLSLILFLALSGNACV LLALRTTRHKHSRLFFFMKHLSIADLAVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTEAAAA EASAGAEGAAADCAGRAALARVSNVKLISKAKIRTVKMTFIVVLAFIVCWTPFFFKQMWS VWDADAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFQDLVQRFLCCSFRRLKGSQLG ETSVTKKIHSYTFVLSRHSSSQRSCSQPSTV
Uniprot No.

Target Background

Function
The oxytocin receptor is a G protein-coupled receptor responsible for mediating the effects of oxytocin. Its activation triggers a phosphatidylinositol-calcium second messenger system.
Database Links

UniGene: Oar.823

Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the sheep oxytocin receptor?

The sheep oxytocin receptor is a G-protein coupled receptor characterized by seven hydrophobic transmembrane regions. The coding region of sheep OXTR cDNA contains 1176 bp from start codon to stop codon. The receptor shows high homology to OXTRs of human, rat, pig, and cattle, though the sheep uterine oxytocin receptor is at least 2 amino acids longer than those of other species. When expressed in Cos-7 cells, it induces oxytocin responsiveness in terms of phosphoinositide turnover .

How heterogeneous are OXTR transcripts in sheep, and why is this significant for researchers?

Northern blotting analysis reveals that sheep OXTR mRNA exhibits significant heterogeneity, similar to uterine oxytocin receptor mRNA in other species. Research has identified that this heterogeneity is partially attributed to the alternative use of polyadenylation sites. More importantly, the pattern of OXTR gene expression in sheep is not only tissue-specific but also highly function-related, with multiple transcripts observed in the endometrium and myometrium, whereas only a single transcript appears in the pituitary gland and corpus luteum . This heterogeneity has significant implications for experimental design, as researchers must consider tissue-specific expression patterns when studying OXTR function.

What is known about the binding kinetics of sheep OXTR with oxytocin?

Meta-analysis has revealed significant homogeneity in OXT-OXTR affinity across experiments and species, with a dissociation constant (Kd) ranging from 0.52 to 9.32 nM and a mean Kd of 1.48 ± 0.36 nM. Specific binding parameters include Kd = 1.6 nM, kon = 6.8 × 10⁵ M⁻¹ min⁻¹, and koff = 0.0011 min⁻¹ . These kinetic parameters are essential for researchers developing binding assays or interpreting interaction studies between oxytocin and its receptor.

How is OXTR expression regulated in sheep reproductive tissues?

The expression of sheep endometrial oxytocin receptor is primarily controlled by ovarian steroid hormones and by trophoblast interferon (IFN-tau). Research indicates that protein kinase C, rather than tyrosine kinases, is involved in the effect of IFN-tau on oxytocin receptor expression. Inhibitors of protein kinase C and down-regulation of protein kinase C partially block receptor expression in ovine endometrial explants during culture, when the explants are taken during the luteal phase of the cycle .

What temporal patterns of OXTR expression occur during the estrous cycle in sheep?

Studies indicate that uterine oxytocin receptor concentrations increase significantly over the late luteal phase of the estrous cycle in sheep. Analysis of oxytocin receptor data reveals a significant difference when concentrations observed on day 10 were compared with those observed on days 11 and 12 (P<0.001), though concentrations on days 11 and 12 did not differ significantly from each other (P>0.05) . This temporal regulation is thought to play an important role in determining the cycle length by facilitating the effect of oxytocin on uterine prostaglandin release.

How does OXTR expression change during pregnancy, and what methodological approaches best capture these changes?

At the end of pregnancy, there is a dramatic increase in the number of oxytocin receptors, indicating the importance of OXTR in the process of labor . To accurately measure these changes, researchers should employ a combination of techniques including Northern blotting for transcript analysis, RT-PCR for quantitative expression, and radioligand binding assays for protein-level quantification. When measuring OXTR concentrations, researchers should be aware that values don't always correlate well with functional responses, suggesting that post-translational modifications or receptor coupling efficiency may vary across physiological states.

What common OXTR genetic variants have been identified, and how do they affect receptor function?

Research has identified five prevalent OXTR variants: V45L, P108A, L206V, V281M, and E339K. Functional studies reveal that these variants significantly affect OXT-OXTR binding dynamics. Specifically, variants P108A and L206V show increased OXTR complex formation (by 58% and 81% respectively), while variants V281M and E339K demonstrate substantially compromised binding capacity (decreased by 55% and 29% respectively) . These differences in binding capacity have important implications for interpreting experimental results and for understanding individual variation in oxytocin responses.

How can researchers compensate for reduced binding capacity in certain OXTR variants?

Mathematical modeling suggests that for variants with compromised binding capacity, researchers can achieve wild-type levels of activation by adjusting oxytocin concentrations and timing. For example, V281M OXTR variants can achieve wild-type activation levels by administering 2.5 μM OXT (to reach wild-type complex formation until 24 seconds) or 4.5 μM OXT (to exceed wild-type complex formation until 45 seconds). Similarly, E339K OXTRs require 1.5 μM OXT to achieve wild-type complex formation until 36 seconds, or 2.5 μM OXT to exceed wild-type levels until 90 seconds . This compensatory approach is valuable for experimental protocols involving these variants.

What advanced methods are available for characterizing novel OXTR variants in sheep?

For characterizing novel OXTR variants, researchers should employ a comprehensive approach including:

  • cDNA sequencing to identify nucleotide alterations

  • Expression systems (such as Cos-7 or HEK293T cells) to evaluate receptor functionality

  • Radioligand binding assays to determine binding kinetics

  • Signaling assays to assess downstream pathway activation

  • Mathematical modeling to predict functional consequences of altered binding dynamics

Additionally, researchers should consider cell-specific factors, as the same variant may behave differently in different cell types due to variations in surface localization and the cellular environment .

What cell models are most appropriate for studying recombinant sheep OXTR?

Research indicates that different cell types exhibit distinct OXTR binding characteristics. Mathematical modeling predicts that OXTR complex reaches maximum occupancy at 10 nM OXT in myometrial cells and at 1 μM in HEK293T cells . This significant difference highlights the importance of cell type selection for experimental design. For studies focusing on physiological relevance, primary ovine myometrial cells or endometrial explants are preferable. For molecular characterization studies, HEK293T cells and Cos-7 cells have been successfully used for expression of functional sheep OXTR .

What are the optimal conditions for RT-PCR amplification of sheep OXTR?

Based on research methodologies, optimal RT-PCR conditions for sheep OXTR include careful primer design targeting conserved regions. Studies have successfully employed primers designed based on known sequences, with optimization of RT-PCR conditions including template concentration, primer concentration, annealing temperature, and cycle number . While specific optimization parameters may vary between laboratories, researchers should consider that the heterogeneity of OXTR transcripts may necessitate multiple primer sets to capture all relevant variants.

How can researchers effectively measure OXTR binding capacity in tissue samples?

For measuring OXTR binding capacity in tissue samples, radioligand binding assays using [³H]oxytocin have proven effective. The established protocol involves tissue homogenization, membrane preparation, and incubation with radiolabeled oxytocin. Specific binding can be calculated using the specific activity of added [³H]oxytocin, with scintillation counting conducted at an efficiency of approximately 61%. Researchers should account for nonspecific binding (typically around 0.8% of total label) and establish a sensitivity limit (e.g., 11.5 fmol oxytocin bound mg⁻¹ protein). For quality control, intra-assay CV of approximately 6.1% and interassay CV of 6.9% can be expected .

What is the relationship between OXTR expression and prostaglandin release in sheep?

Research demonstrates a significant correlation between oxytocin receptor expression and prostaglandin F2α (PGF2α) release. On day 12 of the estrous cycle, a positive relationship exists between mean plasma total estradiol (mPTE) and PGFM peak response (P<0.01; R value=0.732), and between mPTE and PGFM mean response (P<0.05; R value=0.598). On day 11, there is a negative relationship between mean plasma total progesterone (mPTP) and PGFM mean response (P<0.05; R value=0.590) . These correlations highlight the complex interplay between steroid hormones, oxytocin receptor expression, and prostaglandin release in regulating reproductive processes.

How does recombinant sheep OXTR compare functionally to endogenous receptors?

When expressing recombinant sheep OXTR in cell systems, researchers should consider that while the basic binding properties may be preserved, the cellular context significantly influences receptor functionality. Studies comparing OXTR complex formation between different cell types show that factors beyond primary sequence, such as cell-surface localization and the cellular environment, impact receptor function . To ensure physiological relevance, researchers working with recombinant OXTR should validate findings using endogenous receptor systems when possible, particularly when studying complex signaling pathways or regulatory mechanisms.

What role does OXTR play in the maternal recognition of pregnancy in sheep?

The sheep endometrial oxytocin receptor plays a central role in the events leading to the establishment of pregnancy, specifically in the maternal recognition of pregnancy. Expression of the receptor is regulated by trophoblast interferon (IFN-tau), which appears to act through protein kinase C-mediated pathways . Understanding this regulation is crucial for researchers studying early pregnancy, as the modulation of OXTR expression helps establish the appropriate uterine environment for embryo implantation and development.

How can mathematical modeling enhance our understanding of OXTR variant effects in sheep?

Mathematical modeling offers valuable insights into OXTR variant effects by predicting receptor-ligand binding dynamics under various conditions. Models parameterized with cell-specific OXTR surface localization measurements and binding kinetics can predict complex formation for different variants and cell types. This approach has successfully recapitulated the effects of genetic variants in both experimental and physiologically relevant systems . Researchers can use such models to guide experimental design, interpret data across different cell types, and predict compensatory strategies for variants with altered binding properties.

What are the implications of mRNA editing in OXTR transcripts for sheep reproductive physiology?

Research has provided evidence of mRNA editing in both the coding regions and the 3'untranslated regions of OXTR gene transcripts in ovine endometrium, representing the first demonstration of this phenomenon for OXTR mRNA . This editing process may contribute to the functional diversity of OXTR across different tissues and physiological states. For researchers, this finding suggests that sequence analysis at the genomic DNA level may not fully capture the functional diversity of OXTR proteins, necessitating transcript-level analysis to understand the complete range of receptor variants present in specific tissues.

How might tissue-specific OXTR transcript patterns inform targeted therapeutic approaches?

The observation that OXTR gene expression patterns in sheep are both tissue-specific and function-related, with multiple transcripts in the endometrium and myometrium but single transcripts in the pituitary gland and corpus luteum , has significant implications for targeted therapeutic approaches. This differential expression suggests that it may be possible to develop interventions that selectively target specific OXTR variants or tissues. Researchers exploring therapeutic applications should consider these tissue-specific patterns when designing drugs or biological agents aimed at modulating oxytocin-mediated processes in reproductive tissues.

What are the reference binding parameters for sheep OXTR across different experimental systems?

ParameterValueExperimental SystemReference
Kd1.6 nMMeta-analysis value
kon6.8 × 10⁵ M⁻¹ min⁻¹Meta-analysis value
koff0.0011 min⁻¹Meta-analysis value
Kd range0.52-9.32 nMAcross species and experiments
Mean Kd1.48 ± 0.36 nMAcross species and experiments
Maximum occupancy concentration (myometrial cells)10 nMMathematical model prediction
Maximum occupancy concentration (HEK293T cells)1 μMMathematical model prediction

How do OXTR variants affect complex formation capacity?

OXTR VariantEffect on Complex FormationPercentage ChangeCompensatory OXT ConcentrationReference
Wild typeBaseline--
P108AIncrease+58%-
L206VIncrease+81%-
V281MDecrease-55%2.5-4.5 μM
E339KDecrease-29%1.5-2.5 μM

This reference table provides researchers with quantitative data on how different OXTR variants affect receptor function, which is essential for experimental design and data interpretation when working with these variants.

What strategies can address inconsistent OXTR expression levels in recombinant systems?

When facing inconsistent OXTR expression levels in recombinant systems, researchers should:

  • Optimize transfection conditions specific to the cell type being used

  • Consider stable cell lines for more consistent expression

  • Quantify surface receptor expression using techniques such as flow cytometry or cell-surface ELISA

  • Account for cell-specific factors that may influence receptor trafficking and membrane localization

  • Include appropriate controls to normalize for expression differences when comparing variant effects

These approaches are particularly important when studying OXTR variants, as differences in expression levels can confound interpretation of functional differences .

How can researchers address discrepancies between in vitro binding assays and cellular response measurements?

Discrepancies between binding assays and functional responses may reflect the complexity of OXTR signaling pathways. Studies have shown that the concentration of OXTRs measured in endometrial tissue doesn't always correlate well with functional responses , suggesting that factors beyond simple binding affinity influence receptor function. To address these discrepancies, researchers should:

  • Measure multiple signaling outputs (e.g., calcium mobilization, cAMP production)

  • Examine receptor coupling efficiency to different G-proteins

  • Consider the influence of scaffold proteins and co-receptors

  • Evaluate receptor internalization and recycling kinetics

  • Assess potential cross-talk with other signaling pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.