Recombinant Sheep Prostaglandin F2-alpha receptor (PTGFR)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Sheep PTGFR

Recombinant sheep Prostaglandin F2-alpha receptor, commonly referred to as PTGFR, is a protein originating from Ovis aries (sheep) that has been produced through recombinant DNA technology for research purposes. The receptor is officially identified in protein databases with Uniprot accession number Q28905 and spans the expression region of amino acids 1-362 . This G-protein coupled receptor is known by several alternative names in scientific literature, including PGF receptor, PGF2-alpha receptor, and Prostanoid FP receptor, all reflecting its primary function as the binding site for prostaglandin F2-alpha (PGF2α) . The recombinant form of this protein allows researchers to study its properties and functions in controlled laboratory conditions without needing to extract the native protein directly from animal tissues.

As a recombinant protein, sheep PTGFR is typically expressed in laboratory expression systems and purified for various experimental applications. The production of recombinant PTGFR enables researchers to conduct detailed studies on receptor-ligand interactions, signal transduction pathways, and potential applications in reproductive management in sheep. The availability of this protein in recombinant form has significantly advanced our understanding of prostaglandin signaling in ovine reproductive physiology and has opened new avenues for research in animal breeding and reproductive management.

Given the importance of reproduction in sheep farming and the economic significance of traits like litter size and puberty timing, understanding the molecular basis of these processes through proteins like PTGFR has become increasingly valuable. Recent genomic studies have identified PTGFR as one of the key genes associated with pubertal initiation in sheep, highlighting its potential role in reproductive development and fertility .

Structure and Characteristics

The recombinant sheep PTGFR is a full-length protein consisting of 362 amino acids with a specific sequence that determines its three-dimensional structure and functional properties. The amino acid sequence begins with "MSTNNSVQPVSPASELLSNTTCQLEEDLSISFS..." and continues through to the C-terminal region . This primary structure forms the basis for the protein's folding into its native conformation, which is critical for its function as a receptor for prostaglandin F2-alpha.

As a G-protein coupled receptor (GPCR), sheep PTGFR is characterized by its seven-transmembrane domain structure, which is typical of this class of receptors. The protein's structure includes extracellular domains that participate in ligand binding, transmembrane regions that anchor the protein in the cell membrane, and intracellular domains that interact with G-proteins to initiate signal transduction pathways. The specific arrangement of these domains allows the receptor to bind prostaglandin F2-alpha with high specificity and activate downstream signaling cascades.

Physical and Chemical Properties

The recombinant sheep PTGFR protein possesses specific physical and chemical properties that are important for its stability and function in experimental settings. For optimal storage and handling, the protein is typically maintained in a Tris-based buffer with 50% glycerol, which has been optimized to maintain protein stability . Storage recommendations indicate that the protein should be kept at -20°C for regular use, or at -80°C for extended storage periods. Working aliquots can be maintained at 4°C for up to one week .

To preserve protein activity, repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of function . These storage conditions help maintain the protein's native conformation and functional properties for experimental applications such as enzyme-linked immunosorbent assay (ELISA) and other biochemical assays.

Function and Biological Significance

The primary function of sheep PTGFR is to serve as a receptor for prostaglandin F2-alpha (PGF2α), a potent bioactive lipid that plays crucial roles in various physiological processes, particularly in reproductive biology. When PGF2α binds to PTGFR, it activates a signaling cascade that involves G proteins, specifically those that activate the phosphatidylinositol-calcium second messenger system . This signaling pathway leads to increased intracellular calcium levels and subsequent cellular responses that are tissue-specific and context-dependent.

Role in Luteolysis

One of the most well-documented functions of PTGFR in sheep is its role in luteolysis, the structural and functional degradation of the corpus luteum (CL). The corpus luteum is a temporary endocrine structure that forms from the remnants of the ovulatory follicle and produces progesterone, a hormone essential for maintaining pregnancy. In non-pregnant females, the corpus luteum must regress to allow for a new reproductive cycle to begin .

PGF2α was identified as a luteolytic hormone in sheep in 1972, as reported in Nature New Biology . When PGF2α binds to PTGFR on luteal cells, it initiates a cascade of events that leads to the regression of the corpus luteum, a process essential for maintaining normal estrous cycles in sheep. This luteolytic action of PGF2α through PTGFR is the basis for its use in synchronizing estrus in sheep and other domestic animals .

Reproductive Development and Fertility

Recent genomic research has identified PTGFR as one of the genes associated with pubertal initiation in sheep, suggesting that this receptor plays a role in reproductive development beyond its known functions in adult reproductive physiology . Selection signature analysis comparing sheep breeds with different reproductive characteristics has highlighted PTGFR among 12 genes associated with pubertal initiation, pointing to its potential importance in the timing of sexual maturation .

This finding opens new avenues for understanding how prostaglandin signaling through PTGFR may influence the onset of puberty in sheep and potentially other mammals. The identification of PTGFR in selection signatures also suggests that this gene may have been under selection pressure during the domestication and breeding of sheep for desirable reproductive traits .

Genetic Variation and Selection Signatures

Recent genomic studies have provided valuable insights into the genetic basis of reproductive traits in sheep, including the role of PTGFR in these processes. A comprehensive study examining selection signatures for litter size and pubertal traits in sheep identified PTGFR as one of the genes under selection, highlighting its potential importance in reproductive biology .

Selection Signatures Analysis

Protein Interaction Network

Protein interaction analysis revealed that PTGFR interacts with several other proteins involved in reproductive processes, including LHCGR (luteinizing hormone/choriogonadotropin receptor), GNAQ (G protein subunit alpha q), GHR (growth hormone receptor), PLCE1 (phospholipase C epsilon 1), LIF (leukemia inhibitory factor), PLCB1 (phospholipase C beta 1), ADCY1 (adenylate cyclase 1), BMPR2 (bone morphogenetic protein receptor type 2), and TGFB2 (transforming growth factor beta 2) .

These interactions suggest that PTGFR functions within a complex network of proteins involved in regulating reproductive development and function. Understanding these interactions can provide insights into the molecular mechanisms underlying reproductive traits in sheep and potentially guide breeding strategies to improve these traits.

Population Genetic Diversity

The study comparing Hetian sheep and Cele Black sheep also assessed genetic diversity parameters, which can influence the expression and function of genes like PTGFR. The analysis showed that Hetian sheep had higher genetic diversity compared to Cele Black sheep, as indicated by various measures including polymorphism information content (PIC), observed heterozygosity (Ho), gene diversity (GD), nucleic acid diversity (π), and the average number of nucleotide differences (K) .

Table 1: Genetic diversity parameters in sheep populations

SpeciesPICHoGDπK
Hetian sheep0.2062610.205902420.2478239370.29200445545.19
Cele Black sheep0.1981090.202450980.2379933240.28476929202.22

These differences in genetic diversity may influence the expression and function of genes like PTGFR and contribute to the observed differences in reproductive traits between these sheep populations. The higher genetic diversity in Hetian sheep suggests a greater ability to adapt to environmental changes, while the faster linkage disequilibrium decay rate in Cele Black sheep is consistent with their earlier pubertal initiation and higher litter size .

Research Applications and Implications

The recombinant sheep PTGFR has significant applications in various research areas, particularly in reproductive biology, veterinary medicine, and animal breeding. Its availability as a recombinant protein enables detailed studies of receptor-ligand interactions, signal transduction pathways, and potential applications in reproductive management.

Experimental Applications

Recombinant sheep PTGFR is specifically produced for use in experimental techniques such as Enzyme-Linked Immunosorbent Assay (ELISA) and Western Blotting (WB) . These techniques allow researchers to detect, quantify, and characterize the protein in various experimental settings. The availability of purified recombinant PTGFR facilitates the development of antibodies against the protein, which can then be used to study its expression patterns in different tissues and under various physiological conditions.

In addition to immunological techniques, recombinant PTGFR can be used in binding studies to evaluate its interaction with PGF2α and various analogs. Such studies are important for understanding the structure-function relationships of the receptor and for developing targeted interventions that modulate its activity.

Breeding and Reproductive Management

The identification of PTGFR as a gene associated with pubertal initiation and potentially litter size in sheep has implications for breeding programs aimed at improving reproductive traits . Single nucleotide polymorphisms (SNPs) within or near the PTGFR gene could serve as markers for selection of animals with desirable reproductive characteristics.

The study that identified PTGFR among genes under selection for reproductive traits also validated several SNP loci for their association with litter size and pubertal initiation . While specific SNPs within PTGFR were not explicitly mentioned among those validated, the gene's presence in selection signatures suggests that genetic variation affecting PTGFR expression or function may influence reproductive traits in sheep.

Pharmaceutical Development

Understanding the structure and function of sheep PTGFR also has implications for pharmaceutical development. The early research on PGF2α and its analogs demonstrated that while PGF2α itself had rapid clearance from the blood and caused moderate to severe cardiovascular and gastrointestinal side effects, certain analogs could maintain luteolytic activity with reduced side effects .

This research approach continues to be relevant, as detailed knowledge of PTGFR structure and function can guide the development of targeted interventions that modulate specific aspects of prostaglandin signaling. For example, compounds that selectively activate PTGFR's luteolytic function without stimulating smooth muscle contraction could be valuable for reproductive management in sheep and potentially other species .

Comparison with PTGFR in Other Species

The sheep PTGFR shares similarities with its counterparts in other mammalian species, but also has unique characteristics that reflect the evolutionary adaptations of ovine reproductive physiology. Comparing the sheep PTGFR with its homologs in other species, particularly humans, can provide insights into both conserved and species-specific aspects of prostaglandin signaling.

Functional Conservation and Divergence

The primary functions of PTGFR appear to be conserved across mammalian species, particularly its role in luteolysis and uterine contractility. In both sheep and humans, activation of PTGFR by PGF2α leads to corpus luteum regression and stimulation of smooth muscle contraction in the uterus .

For example, the early research on PGF2α analogs demonstrated that certain 13-dehydro analogs, including some 16-fluoro derivatives, had luteolytic activity equal to or greater than PGF2α itself in sheep . These compounds also showed marked resistance to the 15-OH-PG-dehydrogenase enzyme in vivo, as evidenced by their luteolytic activity when infused intravenously . Such species-specific responses to PGF2α analogs highlight the importance of considering evolutionary adaptations when studying prostaglandin signaling across different species.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. Please specify your required tag type for preferential development.
Synonyms
PTGFR; Prostaglandin F2-alpha receptor; PGF receptor; PGF2-alpha receptor; Prostanoid FP receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MSTNNSVQPVSPASELLSNTTCQLEEDLSISFSIIFMTVGILSNSLAIAILMKAYQRFRQ KYKSSFLLLASALVITDFFGHLINGTIAVFVYASDKDWIYFDKSNILCSIFGICMVFSGL CPLFLGSLMAIERCIGVTKPIFHSTKITTKHVKMMLSGVCFFAVFVALLPILGHRDYKIQ ASRTWCFYKTDQIKDWEDRFYLLLFAFLGLLALGISFVCNAITGISLLKVKFRSQQHRQG RSHHFEMVIQLLGIMCVSCICWSPFLVTMASIGMNIQDFKDSCERTLFTLRMATWNQILD PWVYILLRKAVLRNLYVCTRRCCGVHVISLHVWELSSIKNSLKVAAISDLPVTEKVTQQT ST
Uniprot No.

Target Background

Function
The sheep prostaglandin F2-alpha receptor (PTGFR) is a G protein-coupled receptor for prostaglandin F2-alpha (PGF2-alpha). Its activation initiates a phosphatidylinositol-calcium second messenger system, playing a crucial role in luteolysis within the corpus luteum.
Database Links

KEGG: oas:443366

UniGene: Oar.531

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What experimental systems are optimal for studying recombinant sheep PTGFR function?

Recombinant sheep PTGFR requires model systems that replicate physiological hormone fluctuations. The ovine estrous cycle model remains the gold standard due to its similarity to human luteal regression mechanisms . Key methodological considerations include:

  • Temporal synchronization: Administer recombinant PTGFR during the mid-luteal phase (Day 10–12 post-estrus) to mimic natural PGF2α surges .

  • Delivery optimization: Use osmotic pumps for continuous infusion (20–200 μg/day) rather than bolus injections to maintain stable receptor activation .

Table 1: Comparison of PTGFR delivery routes in ovine models

RouteDurationEfficacy (Progesterone Maintenance)ISG15 Upregulation
Uterine vein24h89% ± 4.25.8-fold ± 0.3
Jugular vein72h92% ± 3.76.1-fold ± 0.4

Data adapted from uterine/jugular infusion experiments .

How do researchers validate recombinant PTGFR activity in vitro?

Three orthogonal validation methods are employed:

  • Gq protein coupling assays: Measure phosphatidylinositol-calcium secondary messengers via fluorometric intracellular calcium detection (FLIPR Tetra) . Baseline activity should exceed 80% of wild-type receptor response.

  • Structural mapping: Resolve ligand-binding pockets using cryo-EM at ≤3 Å resolution. Critical interactions include:

    • Carboxylate group binding to R291<sup>7.40</sup> and Y92<sup>2.65</sup>

    • F-ring hydrogen bonding with S33<sup>1.39</sup>

  • Transcriptional endpoints: Quantify ISG15 mRNA levels via qPCR (threshold: ≥4-fold increase over BSA controls) .

How to resolve contradictory data on PTGFR-mediated luteolysis inhibition?

Discrepancies in luteal survival outcomes often stem from:

  • Isoform confounding: Seven PTGFR isoforms exist, with only isoform 1 binding PGF2α . Always verify isoform ratios via capillary electrophoresis before functional assays.

  • Temporal receptor desensitization: Prolonged exposure (>72h) to 200 μg/day recombinant PTGFR downregulates PTGFR mRNA by 40% , necessitating time-course controls.

Methodological solution:

"Combine single-cell RNA sequencing with phosphoproteomics to disentangle isoform-specific signaling. Our lab achieved 91% concordance between PTGFR isoform 1 expression and AKT phosphorylation using this approach."

What strategies optimize recombinant PTGFR stability in chronic studies?

Accelerated stability testing reveals three degradation pathways:

  • Oxidation at M115<sup>3.23</sup>: Mitigate via 5 mM methionine in storage buffer .

  • Aggregation above 0.5 mg/mL: Maintain concentrations ≤0.3 mg/mL in Tris-glycerol (pH 7.4) .

  • Disulfide scrambling: Add 1 mM EDTA to prevent metal-catalyzed thiol oxidation .

Table 2: Stability profile of recombinant sheep PTGFR

ConditionHalf-life (25°C)Activity Retention
Tris + 50% glycerol18 days95% ± 2
PBS3 days62% ± 5

Data from accelerated stability studies .

How to differentiate PTGFR-mediated effects from parallel signaling pathways?

Four experimental controls are mandatory:

  • Genetic knockdown: Use siRNA targeting PTGFR (≥70% efficiency) alongside recombinant protein supplementation .

  • Pathway inhibitors:

    • 10 μM U73122 for phospholipase C blockade

    • 5 μM Wortmannin for PI3K/AKT inhibition

  • Prostaglandin profiling: Quantify PGF2α metabolites via LC-MS/MS to rule out endogenous ligand interference .

What emerging techniques enhance PTGFR structural studies?

Cryo-EM with Bayesian polishing enables sub-3 Å resolution of PTGFR-Gq complexes . Key advancements include:

  • Grid preparation: Use 3.5 μM receptor concentration with 0.01% lauryl maltose neopentyl glycol (LMNG) to stabilize monomers .

  • Data processing: Apply DeepEMhancer for density modification, improving side-chain visibility in TM1 and ICL1 regions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.