Recombinant Sheep Prostaglandin G/H synthase 1 (PTGS1)

Shipped with Ice Packs
In Stock

Description

Biochemical Characterization

PTGS1’s enzymatic activity is quantified using oxygen consumption assays. Key parameters include:

ParameterConditionUnit Definition
Buffer0.1 M Tris-HCl, pH 8.0, 100 μM arachidonate, 5 mM EDTA, 2 mM phenol, 1 μM hematinOne unit = 1 nmol O₂ consumed/min at 37°C
Temperature37°CMeasured using Gilson Model 5/6 H oxygraph with Clark electrode

The enzyme’s dual cyclooxygenase and peroxidase activities are critical for PGH₂ synthesis .

Role in Prostaglandin Synthesis

PTGS1 initiates the conversion of arachidonic acid to PGH₂, which is further metabolized into prostaglandins (e.g., PGE₂, PGF₂α) and thromboxanes (TXA₂) . This pathway regulates:

  • Gastrointestinal mucosal protection

  • Renal blood flow

  • Platelet aggregation

Interaction with NSAIDs

Aspirin acetylates Ser530, irreversibly inhibiting PTGS1’s cyclooxygenase activity . Other NSAIDs (e.g., ibuprofen) compete for the active site .

Polymorphisms and Functional Variants

Human PTGS1 polymorphisms (e.g., R8W, K185T) alter enzyme activity and drug responsiveness in vitro . While sheep-specific variants are less studied, these findings highlight potential species-specific differences in catalytic efficiency.

Applications in Research

Recombinant PTGS1 is used in:

ApplicationDetailsSource
Drug DevelopmentScreening NSAIDs and COX-1 inhibitors
Mechanistic StudiesProbing moonlighting functions (e.g., peroxidase activity)
Cancer ResearchInvestigating PTGS1’s role in tumor angiogenesis

Stability and Handling

ParameterSpecificationSource
Storage-80°C in 80 mM Tris-HCl (pH 8.0), 0.3 mM DDC, 0.1% polysorbate 20, 10% glycerol
Shelf Life≥1 year

Comparative Analysis with Other PTGS1 Isoforms

SpeciesExpression SystemTagsKey Use CasesSource
SheepE. coliNon-taggedNative activity studies
HumanHEK293/Insect cellsHis-tag, Avi-tagStructural studies, inhibitor screening
MouseMammalian cellsMyc/DDK-tagKnockout model validations

Key Research Findings

  1. Moonlighting Function: PTGS1 exhibits both cyclooxygenase and peroxidase activities, enabling dual roles in prostaglandin synthesis .

  2. Aspirin Mechanism: Irreversible acetylation at Ser530 blocks access to the active site, reducing PGH₂ production .

  3. Pathway Involvement: Central to arachidonic acid metabolism, platelet activation, and tumor progression .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
PTGS1; COX1; Prostaglandin G/H synthase 1; Cyclooxygenase-1; COX-1; Prostaglandin H2 synthase 1; PGH synthase 1; PGHS-1; PHS 1; Prostaglandin-endoperoxide synthase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-600
Protein Length
Full Length of Mature Protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
ADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRP SPSFIHFMLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSN VSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQH FTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPP SVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWG DEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQL YHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHI LHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFY PGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATL KKLVCLNTKTCPYVSFHVPDPRQEDRPGVERPPTEL
Uniprot No.

Target Background

Function
Prostaglandin G/H synthase 1 (PTGS1), also known as cyclooxygenase-1 (COX-1), is a bifunctional enzyme involved in the biosynthesis of prostanoids, a class of C20 oxylipins primarily derived from arachidonic acid. Prostanoids play a crucial role in the inflammatory response. PTGS1 exhibits both cyclooxygenase and peroxidase activities. The cyclooxygenase activity oxygenates arachidonic acid (AA, C20:4(n-6)) to the hydroperoxy endoperoxide prostaglandin G2 (PGG2), and the peroxidase activity reduces PGG2 to the hydroxy endoperoxide PGH2. PGH2 serves as the precursor for all 2-series prostaglandins and thromboxanes. This intricate transformation is initiated by the abstraction of hydrogen at carbon 13 (with S-stereochemistry), followed by the insertion of molecular O2 to form the endoperoxide bridge between carbon 9 and 11, defining the structure of prostaglandins. The insertion of a second molecule of O2 (bis-oxygenase activity) yields a hydroperoxy group in PGG2, which is subsequently reduced to PGH2 by two electrons. PTGS1 is involved in the constitutive production of prostanoids, particularly in the stomach and platelets. In gastric epithelial cells, PTGS1 plays a key role in the generation of prostaglandins like prostaglandin E2 (PGE2), essential for cytoprotection. In platelets, PTGS1 is involved in the generation of thromboxane A2 (TXA2), promoting platelet activation and aggregation, vasoconstriction, and proliferation of vascular smooth muscle cells.
Gene References Into Functions
  1. mechanisms for the PGHS/AA/GSH-dependent formation of MDA, 15(S)-8-iso-prostaglandin F(2alpha) and other F(2)-isoprostanes PMID: 22982857
  2. The study compares crystal structures of COX1 in the presence and absence of different nonsteroidal antiinflammatory drugs and COX-2 inhibitors. PMID: 20669977
  3. regulation of expression of these enzymes is region-specific, suggesting that the activity of PGHS-1 & PGHS-2 is likely to be critical for brain development in the late-gestation ovine fetus. PMID: 19706338
  4. N-(3-hydroxyphenyl)arachidonoylamide is a substrate but not a inhibitor of PGHS-1. PMID: 19928795
  5. oxygenase reaction occurs by a sequential mechanism which most likely involves reversible abstraction of a hydrogen atom from the fatty acid prior to the trapping of the delocalized substrate radical by O2. PMID: 17355126

Show More

Hide All

Database Links

KEGG: oas:443551

UniGene: Oar.445

Protein Families
Prostaglandin G/H synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein.

Q&A

What is Prostaglandin G/H synthase 1 and what is its role in prostaglandin biosynthesis?

Prostaglandin G/H synthase 1 (PTGS1/COX-1) is a membrane-bound enzyme that catalyzes the rate-limiting step in prostanoid biosynthesis. Specifically, PTGS1 possesses both cyclooxygenase and peroxidase activities, converting arachidonic acid to prostaglandin G2 through a cyclooxygenase reaction, followed by the reduction of prostaglandin G2 to prostaglandin H2 via peroxidase activity . This bifunctional enzyme (EC 1.14.99.1) is constitutively expressed in most tissues and is responsible for the physiological production of prostaglandins involved in homeostatic functions .

To study this enzyme effectively, researchers should note that PTGS1 requires integration into phospholipid membranes for optimal activity. Experimental protocols should therefore incorporate appropriate detergents or phospholipid vesicles when working with the purified recombinant protein. Additionally, the enzyme contains a heme prosthetic group essential for its peroxidase activity, which must be preserved during purification and experimental procedures.

How does sheep PTGS1 differ from human PTGS1 in structure and function?

What expression systems are most effective for producing recombinant sheep PTGS1?

For recombinant expression of sheep PTGS1, multiple systems have been employed with varying degrees of success:

Expression SystemAdvantagesLimitationsTypical Yield
Insect Cells (Sf9/Sf21)Proper folding and post-translational modificationsHigher cost, longer production time2-5 mg/L culture
Mammalian Cells (HEK293, COS)Closest to native glycosylation patternLowest yield, highest cost0.5-2 mg/L culture
Yeast (Pichia pastoris)Higher yield, inducible expressionDifferent glycosylation pattern5-10 mg/L culture
E. coliHighest yield, lowest costLacks post-translational modifications, often inactive10-20 mg/L culture

The baculovirus-insect cell system generally offers the best compromise between yield and proper folding/modification. When using this system, co-expression with chaperones and heme-loading factors can significantly improve the yield of active enzyme. For structural studies requiring high protein quantities, E. coli systems may be used followed by in vitro refolding and heme incorporation, though activity recovery is typically lower.

What are the optimal conditions for maintaining stability and activity of recombinant sheep PTGS1 in vitro?

Recombinant sheep PTGS1 stability is critically dependent on several factors:

  • Buffer composition: 50-100 mM Tris-HCl or phosphate buffer (pH 7.2-7.6) with 300-500 mM NaCl provides optimal stability.

  • Detergent selection: 0.1% Tween-20 or 0.5-1.0% n-octyl-β-D-glucopyranoside helps maintain membrane protein solubility without denaturing the enzyme.

  • Reducing agents: Include 1-5 mM DTT or 2-mercaptoethanol to prevent oxidation of critical cysteine residues.

  • Protease inhibitors: A cocktail containing PMSF, leupeptin, and aprotinin prevents degradation during storage.

  • Glycerol content: 10-20% glycerol significantly improves long-term stability at -80°C.

For activity assays, consistent temperature control (25-30°C) and physiological calcium levels (2 mM CaCl₂) are critical. The enzyme shows significant activity loss after freeze-thaw cycles, so single-use aliquots are recommended. Oxygen presence is essential for the cyclooxygenase reaction, while controlled peroxide concentrations are needed for initiating the peroxidase cycle without causing enzyme inactivation.

How can site-directed mutagenesis be used to investigate the catalytic mechanism of sheep PTGS1?

Site-directed mutagenesis represents a powerful approach for probing structure-function relationships in sheep PTGS1. Key targets for mutagenesis include:

  • Catalytic residues: Mutations of Tyr-385, which forms the tyrosyl radical essential for cyclooxygenase activity, can differentiate between cyclooxygenase and peroxidase functions.

  • Aspirin binding site: Modifications of Ser-530 directly impact acetylation by aspirin and subsequent inhibition mechanisms.

  • Substrate channel residues: Altering amino acids lining the hydrophobic channel can reveal determinants of substrate specificity.

  • Heme coordination sites: Mutations affecting histidine residues involved in heme binding allow analysis of the relationship between peroxidase and cyclooxygenase activities.

A methodological workflow typically involves:

  • Designing primers incorporating the desired mutation

  • PCR-based mutagenesis using high-fidelity polymerases

  • Expression in insect cells for proper folding

  • Parallel characterization of cyclooxygenase and peroxidase activities

  • Binding studies with substrates and inhibitors

  • Structural analysis via crystallography when possible

This approach has revealed that the cyclooxygenase and peroxidase activities can be differentially affected by specific mutations, providing evidence for distinct but interconnected catalytic mechanisms.

What purification strategies yield the highest purity and activity for recombinant sheep PTGS1?

Purification of recombinant sheep PTGS1 requires a carefully optimized protocol to maintain structural integrity and enzymatic activity:

Purification StepMethodologyRecoveryPurity
Cell LysisGentle detergent extraction (1% Triton X-100)85-95%10-15%
Affinity ChromatographyImmobilized NSAIDs or His-tag capture70-80%60-80%
Ion ExchangeDEAE or Q-Sepharose (pH 7.4)75-85%85-90%
Size ExclusionSuperdex 200 in detergent buffer80-90%>95%

For highest activity retention, all buffers should contain 0.1 mM heme (to prevent heme loss) and 5% glycerol (for stability). Temperature should be maintained at 4°C throughout the purification process. Using commercially available cDNA clones from sheep vesicular glands, researchers can incorporate affinity tags that facilitate purification while minimizing impact on enzyme structure and function .

A critical quality control step involves assessing both cyclooxygenase and peroxidase activities independently, as certain purification conditions may differentially affect these functions. The ratio between these activities serves as an excellent indicator of enzyme integrity.

How can recombinant sheep PTGS1 be used to screen for novel NSAIDs with improved selectivity profiles?

Recombinant sheep PTGS1 provides an excellent platform for screening novel NSAID candidates. A comprehensive screening approach should include:

  • Primary enzyme inhibition assays: Using purified recombinant sheep PTGS1, measure IC₅₀ values for cyclooxygenase activity inhibition with oxygen consumption assays or product formation (PGH₂) quantification.

  • Binding kinetics analysis: Surface plasmon resonance (SPR) can determine association/dissociation rates and binding constants, revealing whether compounds exhibit competitive, non-competitive, or time-dependent inhibition.

  • Structural basis assessment: Co-crystallization of recombinant sheep PTGS1 with candidate molecules provides atomic-level insights into binding modes. The serine residue at position 530 is particularly important as it is the site of aspirin acetylation .

  • Selectivity profiling: Parallel testing against recombinant PTGS2 (COX-2) enables calculation of selectivity indices that predict gastrointestinal safety profiles.

  • Molecular dynamics simulations: These computational approaches, using the resolved structure of sheep PTGS1, can predict binding energies and identify novel binding modes for rational drug design.

For meaningful results, it's essential to compare new candidates against reference compounds (e.g., aspirin, ibuprofen, celecoxib) under identical experimental conditions. The aspirin binding site at Ser-530 provides a useful positive control for acetylation-based inhibition mechanisms .

What structural modifications to recombinant sheep PTGS1 can enhance its stability for crystallographic studies?

Enhancing recombinant sheep PTGS1 stability for crystallographic studies requires multiple strategic modifications:

  • Truncation approaches: Removing flexible regions while preserving the catalytic core can significantly improve crystallization propensity. Based on structural analysis, N-terminal truncations removing the signal peptide (first 24 amino acids) and C-terminal truncations preserving the catalytic residues have proven effective .

  • Surface engineering: Substituting surface-exposed hydrophobic residues with hydrophilic alternatives reduces aggregation potential. Key targets include non-conserved residues in surface loops.

  • Glycosylation management: The three potential N-glycosylation sites in sheep PTGS1, primarily in the amino-terminal half, can introduce heterogeneity that hampers crystallization . Strategies include:

    • Expression in GlcNAc transferase I-deficient cells for homogeneous glycosylation

    • Enzymatic deglycosylation with PNGase F under non-denaturing conditions

    • Mutagenesis of N-glycosylation sites (Asn→Gln) that don't affect activity

  • Stabilizing mutations: Introducing disulfide bridges at strategic positions can rigidify flexible regions. Computational design tools can identify optimal positions with minimal impact on catalytic function.

  • Binding partners: Co-crystallization with high-affinity inhibitors (particularly slow, tight-binding compounds) or substrate analogs can lock the enzyme in a defined conformation, facilitating crystal packing.

These approaches have led to successful crystallization of sheep PTGS1 constructs, providing valuable structural information for understanding catalytic mechanisms and inhibitor interactions.

How do post-translational modifications affect the catalytic activity of recombinant sheep PTGS1?

Post-translational modifications significantly impact the catalytic properties of recombinant sheep PTGS1:

  • Glycosylation: The sheep PTGS1 contains three potential N-glycosylation sites, primarily in the amino-terminal half of the molecule . Glycosylation affects:

    • Protein solubility and folding

    • Membrane association

    • Resistance to proteolytic degradation

    • Thermal stability

  • Heme incorporation: Proper insertion of the heme prosthetic group is essential for both peroxidase and cyclooxygenase activities. Insufficient heme loading results in preparations with impaired function, particularly affecting the peroxidase activity.

  • Phosphorylation: Though less studied than other modifications, phosphorylation at specific serine/threonine residues can modulate sheep PTGS1 activity through:

    • Altered membrane association

    • Modified protein-protein interactions

    • Changes in substrate access

  • Acetylation: Beyond the well-known acetylation by aspirin at Ser-530 , endogenous acetylation may serve as a regulatory mechanism affecting catalytic efficiency.

When expressing recombinant sheep PTGS1, researchers should carefully consider the expression system's capacity to perform these modifications. Insect cell systems typically provide the best compromise for studying the impact of post-translational modifications, though mammalian systems more closely recapitulate the native modification pattern.

What are common causes of activity loss in recombinant sheep PTGS1 preparations?

Activity loss in recombinant sheep PTGS1 preparations stems from multiple factors that must be systematically addressed:

A systematic approach to troubleshooting involves assessing enzyme integrity via SDS-PAGE, measuring heme content spectrophotometrically, and comparing cyclooxygenase and peroxidase activities to identify which catalytic function is compromised.

How can discrepancies between in vitro and in vivo activity of recombinant sheep PTGS1 be reconciled?

Reconciling differences between in vitro and in vivo activity of recombinant sheep PTGS1 requires understanding several key factors:

  • Membrane environment: In vitro studies often use detergent-solubilized enzyme, whereas in vivo activity occurs in a complex membrane environment. Methodological approaches to address this include:

    • Reconstitution into liposomes with defined phospholipid composition

    • Utilization of nanodiscs containing native-like membrane components

    • Incorporation of necessary membrane cofactors (phosphatidylcholine, phosphatidylserine)

  • Substrate availability: Arachidonic acid is tightly regulated in cellular systems but often provided in excess in vitro. Comparative studies using physiological substrate concentrations (1-10 μM) provide more translatable results.

  • Redox environment: The cellular redox state significantly impacts PTGS1 activity. In vitro studies should mimic physiological glutathione/glutathione disulfide ratios and include relevant cellular reductants.

  • Protein-protein interactions: PTGS1 interacts with numerous cellular proteins in vivo. Co-expression or addition of known interacting partners (particularly phospholipases and terminal synthases) creates more physiologically relevant conditions.

  • Post-translational modifications: As discussed in section 3.3, modifications affect activity and stability. Using expression systems that recapitulate native modifications improves correlation with in vivo activity.

By systematically addressing these factors, researchers can develop more predictive in vitro models, though some discrepancies will likely remain due to the complexity of cellular environments.

What analytical techniques provide the most reliable quantification of recombinant sheep PTGS1 enzymatic activity?

Reliable quantification of recombinant sheep PTGS1 activity requires selecting appropriate analytical techniques based on the specific reaction being monitored:

For comprehensive activity assessment, researchers should ideally measure both cyclooxygenase and peroxidase activities independently. The cyclooxygenase activity is most reliably quantified by measuring oxygen consumption using Clark-type electrodes or fluorescence-based oxygen sensors. For peroxidase activity, ABTS (2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid)) oxidation provides a sensitive colorimetric assay.

When comparing different enzyme preparations, standardization is critical. Active site titration using tight-binding inhibitors (such as indomethacin) provides accurate active enzyme quantification independent of total protein concentration. This approach accounts for variations in the proportion of catalytically competent enzyme between preparations.

How does sheep PTGS1 compare to PTGS1 from other species as a model for human drug development?

Sheep PTGS1 offers several advantages as a model for human drug development compared to PTGS1 from other species:

SpeciesSequence Identity with Human PTGS1Structural SimilarityInhibitor Profile CorrelationAvailability of Structural Data
Sheep93%Very HighExcellentExtensive
Mouse88%HighGoodLimited
Rat89%HighGoodModerate
Bovine94%Very HighExcellentModerate
Ovine93%Very HighExcellentExtensive

Sheep PTGS1 shares high sequence identity with human PTGS1, particularly in regions critical for catalysis and inhibitor binding. The aspirin acetylation site (Ser-530) is conserved between sheep and human enzymes, making sheep PTGS1 particularly valuable for studying acetylation-dependent inhibition mechanisms .

The extensive structural data available for sheep PTGS1, including high-resolution crystal structures, provides a solid foundation for structure-based drug design. The binding pockets for substrates and inhibitors are highly conserved between sheep and human PTGS1, resulting in excellent correlation of inhibitor profiles.

What experimental approaches can differentiate between PTGS1 and PTGS2 activity in mixed tissue preparations?

Differentiating between PTGS1 and PTGS2 activities in mixed tissue preparations requires a strategic combination of approaches:

  • Selective inhibition profiles:

    • Use PTGS1-selective inhibitors (SC-560, IC₅₀ = 9 nM for PTGS1 vs. 6.3 μM for PTGS2)

    • Use PTGS2-selective inhibitors (celecoxib, IC₅₀ = 0.04 μM for PTGS2 vs. 15 μM for PTGS1)

    • Construct inhibition curves with both selective inhibitors to calculate relative contributions

  • Immunoprecipitation separation:

    • Utilize isoform-specific antibodies to selectively remove one isoform

    • Compare activity before and after immunodepletion

    • Confirm depletion efficiency via Western blotting

  • Expression analysis correlation:

    • Quantify PTGS1 and PTGS2 protein levels via Western blotting

    • Correlate expression levels with total and selective inhibitor-resistant activities

    • Perform regression analysis to determine isoform-specific contributions

  • Product profile analysis:

    • PTGS1 and PTGS2 show subtle differences in product ratios

    • LC-MS/MS analysis of eicosanoid profiles can indicate predominant isoform

    • Apply multivariate analysis to identify isoform-specific product signatures

  • Induction protocols:

    • PTGS1 is largely constitutive, while PTGS2 is inducible

    • Compare activity before and after induction with lipopolysaccharide or cytokines

    • Increased activity post-induction indicates PTGS2 contribution

The most robust approach combines at least two of these methodologies, preferably including a selective inhibition strategy and a direct protein quantification method.

How can recombinant sheep PTGS1 be used to investigate the evolutionary development of prostanoid biosynthesis?

Recombinant sheep PTGS1 serves as an excellent tool for investigating evolutionary aspects of prostanoid biosynthesis through several methodological approaches:

  • Comparative structural analysis:

    • Express and characterize PTGS1 orthologs from species at different evolutionary distances

    • Overlay crystal structures to identify conserved catalytic domains versus variable regions

    • Correlate structural changes with habitat shifts or physiological adaptations

  • Substrate specificity profiling:

    • Test sheep PTGS1 with fatty acid substrates of varying chain lengths and unsaturation patterns

    • Compare enzyme kinetics for non-canonical substrates across species

    • Identify evolutionary shifts in substrate preference related to dietary adaptations

  • Inhibitor sensitivity comparison:

    • Evaluate natural product inhibitors against sheep PTGS1 and orthologs

    • Determine if inhibitor sensitivity correlates with species exposure to plant-derived compounds

    • Investigate co-evolution of PTGS1 with dietary or environmental inhibitory compounds

  • Reconstruction of ancestral sequences:

    • Use phylogenetic analysis to predict ancestral PTGS1 sequences

    • Express and characterize reconstructed ancestral enzymes

    • Identify critical mutations that altered enzyme function during evolution

  • Genomic context analysis:

    • Compare genomic organization of PTGS1 loci across species

    • Identify conserved regulatory elements that control expression

    • Correlate changes in gene structure with evolutionary branch points

These approaches have revealed that while the catalytic core of PTGS1 is highly conserved across species, subtle variations in substrate channel dimensions and surface residues have led to species-specific differences in substrate specificity and inhibitor sensitivity, reflecting adaptations to different physiological requirements and environmental challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.