Recombinant Sheep Sodium/potassium-transporting ATPase subunit beta-1 (ATP1B1)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP1B1

ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, specifically to the subfamily of Na+/K+-ATPases . The sodium/potassium ATPase (Na+/K+-ATPase) functions as an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of sodium and potassium ions across the plasma membrane . These gradients serve fundamental physiological roles, being essential for osmoregulation, sodium-coupled transport of various organic and inorganic molecules, and electrical excitability of nerve and muscle tissues .

The Na+/K+-ATPase enzyme consists of two primary subunits: a large catalytic alpha (α) subunit and a smaller glycoprotein beta (β) subunit . While the alpha subunit contains the machinery for ATP hydrolysis and ion transport, the beta subunit plays a crucial regulatory role. Specifically, the beta-1 subunit regulates the number of sodium pumps transported to the plasma membrane through the assembly of alpha/beta heterodimers . This regulatory function highlights the importance of ATP1B1 in ensuring proper localization and function of the sodium pump complex.

The sheep ATP1B1 protein shares significant structural and functional similarities with its counterparts in other mammalian species. This conservation reflects the fundamental importance of ATP1B1 in cellular physiology, including maintenance of resting potential, regulation of cellular volume, and facilitation of secondary active transport systems across evolutionary history.

Production of Recombinant Sheep ATP1B1

Recombinant sheep ATP1B1 is predominantly produced using Escherichia coli expression systems, which provide an efficient platform for generating substantial quantities of the protein for research and commercial applications . The expression process involves transformation of bacterial cells with a vector containing the sheep ATP1B1 gene sequence optimized for bacterial expression.

To facilitate purification and detection, the recombinant protein is commonly fused with an N-terminal histidine tag (His-tag) . This affinity tag enables efficient purification using metal affinity chromatography techniques, particularly immobilized metal affinity chromatography (IMAC), which exploits the specific binding of histidine residues to metal ions such as nickel or cobalt.

The purification process typically achieves a high level of purity, with commercial preparations exceeding 90% purity as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) . Following purification, the protein is often formulated as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which enhances stability during storage and transportation .

Biochemical Properties

The recombinant sheep ATP1B1 protein exhibits specific biochemical and physical properties that influence its handling, storage, and functionality in experimental settings. These properties must be carefully considered to maintain protein integrity and optimize experimental outcomes.

The protein in its recombinant form is typically provided as a lyophilized powder, which requires reconstitution before use . The recommended reconstitution procedure involves adding deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . To enhance stability during storage, the addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the standard commercial preparation .

Proper storage conditions are crucial for maintaining the integrity and activity of the recombinant protein. The lyophilized form should be stored at -20°C to -80°C upon receipt . After reconstitution, working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided as it may compromise protein quality and functional properties .

The protein demonstrates stability in Tris/PBS-based buffer systems at pH 8.0, suggesting optimal activity under slightly alkaline conditions. While specific activity measurements are not provided in the available sources, the protein is noted to be applicable for SDS-PAGE analysis , suggesting its utility in electrophoretic separation techniques for protein characterization and quality control.

Applications and Research Utilization

Recombinant sheep ATP1B1 has several potential applications in biochemical and biomedical research. The primary documented application is in SDS-PAGE analysis , which suggests its use in protein characterization, antibody validation, and quality control procedures for experimental protocols involving sodium/potassium ATPase systems.

More broadly, recombinant Na+/K+-ATPase subunits like ATP1B1 serve important functions in research into membrane transport mechanisms, ion channel functionality, and cellular energetics. They provide valuable tools for studying the assembly and regulation of the Na+/K+-ATPase complex, which is crucial for understanding cellular physiology and pathophysiology in various tissues and organ systems.

Research on related sodium-potassium ATPase components has revealed significant insights into resistance mechanisms against cardiotonic steroids (CTS) . While these studies primarily focus on the alpha subunit (ATP1A) , the regulatory role of the beta subunit in the functional sodium pump complex implies potential relevance for ATP1B1 in similar research contexts. For example, recent studies have identified epistatic effects between amino acid insertions and substitutions in the ATP1A subunit , suggesting complex evolutionary adaptations that might involve interactions with the beta subunit.

The H1-H2 extracellular loop of the alpha subunit has been identified as particularly important in CTS resistance , and given the close association between alpha and beta subunits, the recombinant sheep ATP1B1 could provide valuable insights into how these subunits interact to regulate pump function and ligand sensitivity.

The commercial availability of recombinant sheep ATP1B1 with high purity and defined specifications facilitates consistent and reproducible research outcomes. The protein's histidine tag enables straightforward detection and purification in experimental settings, enhancing its utility as a research tool for investigating membrane transport processes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ATP1B1; Sodium/potassium-transporting ATPase subunit beta-1; Sodium/potassium-dependent ATPase subunit beta-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEIAFRPNDPKSYMTYVDNIDNFLKKYRDSAQKDDMIFEDCGNVPSELKDRGEFNNEQGERKVCRFKLEWLGNCSGINDETYGYKEGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVQCTGKRDEDKEKVGSIEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Uniprot No.

Target Background

Function
This protein represents the non-catalytic β1 subunit of the Na+/K+-ATPase enzyme. It is crucial for ATP hydrolysis, facilitating Na+ and K+ ion exchange across the plasma membrane. The β1 subunit regulates the number of sodium pumps reaching the plasma membrane by forming α/β heterodimers. It also plays a role in cell adhesion and establishing epithelial cell polarity.
Gene References Into Functions
  1. Studies on the K65C mutant highlight the influence of the conserved charged lysine residue (in β1 isoforms) on the voltage dependence of extracellular cation binding and release. This demonstrates a direct effect on the membrane potential. [PMID: 15851504](https://www.ncbi.nlm.nih.gov/pubmed/15851504)
Database Links

KEGG: oas:443384

UniGene: Oar.421

Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Apical cell membrane; Single-pass type II membrane protein. Cell membrane, sarcolemma.

Q&A

What is the role of ATP1B1 in relation to ATP1A subunits in sodium-potassium ATPase function?

ATP1B1 functions as the essential beta subunit that partners with the catalytic alpha subunit (ATP1A) to form a functional sodium-potassium ATPase. While ATP1A contains the catalytic domain responsible for ATP hydrolysis, ATP1B1 plays crucial roles in:

  • Facilitating proper folding and membrane insertion of the alpha subunit

  • Stabilizing the enzyme complex in the plasma membrane

  • Modulating the enzyme's affinity for ions and ATP

  • Contributing to the enzyme's sensitivity to cardiotonic steroids (CTS)

Recent experimental evidence indicates that ATP1B1 must be co-expressed with ATP1A1 to generate functional recombinant Na⁺/K⁺-ATPase complexes in expression systems, suggesting interdependent folding and assembly mechanisms .

What expression systems are most effective for producing recombinant sheep ATP1B1?

For functional studies of sheep ATP1B1, insect cell expression systems have demonstrated high efficacy. The baculovirus expression system using Spodoptera frugiperda cells has been particularly successful, as evidenced by:

Expression SystemAdvantagesConsiderations
Baculovirus/Sf9High protein yield, proper post-translational modificationsRequires pFastBac Dual vectors for co-expression with ATP1A1
Mammalian cellsNative-like glycosylation patternsLower yields, more expensive
Bacterial systemsCost-effective, high yieldLacks post-translational modifications; often produces non-functional protein

When designing expression constructs, codon optimization for the expression host (e.g., S. frugiperda) significantly improves protein yield. Vectors such as pFastBac Dual allow for simultaneous expression of both ATP1B1 and ATP1A1 subunits under different promoters (p10 and PPH, respectively) .

How can I verify successful expression and proper folding of recombinant sheep ATP1B1?

Verification of properly expressed and folded ATP1B1 requires multiple analytical approaches:

  • Western blotting: Using anti-ATP1B1 antibodies to confirm protein expression at the expected molecular weight (~35 kDa, though this varies based on glycosylation)

  • Functional assays: The most definitive verification comes from measuring Na⁺/K⁺-ATPase activity through:

    • ATP hydrolysis assays (colorimetric phosphate release)

    • Rubidium uptake assays (functional ion transport)

  • Glycosylation analysis: Proper folding often correlates with correct glycosylation, which can be assessed by:

    • PNGase F treatment followed by western blotting

    • Lectin binding assays

  • Complex formation: Co-immunoprecipitation with ATP1A1 confirms proper heterodimer assembly

Proper functional activity of the ATP1A1/ATP1B1 complex serves as the most reliable indicator of correct protein folding and assembly .

What considerations are important when designing site-directed mutagenesis studies of sheep ATP1B1?

When designing site-directed mutagenesis experiments for sheep ATP1B1, researchers should consider:

  • Evolutionary conservation: Focus on residues conserved across species, which often indicates functional importance

  • Domain-specific effects: Mutations in different domains may affect:

    • Interaction with ATP1A1 (primarily N-terminal domain)

    • Membrane trafficking (transmembrane domain)

    • Glycosylation sites (extracellular domain)

  • Mutagenesis strategy:

    • For single mutations: QuickChange II XL Site-Directed Mutagenesis Kit has proven effective

    • For complex modifications: Gene synthesis with inserted mutations is often more efficient

  • Controls: Always include wildtype constructs expressed under identical conditions

  • Validation approach: Plan for multiple functional assays to detect potentially subtle effects

When interpreting results, it's essential to consider epistatic effects, as research on the related ATP1A1 has shown that mutations can have non-additive interactions that significantly impact protein function .

How can I investigate the epistatic effects between ATP1B1 and ATP1A1 mutations?

Investigating epistatic interactions between mutations in ATP1B1 and ATP1A1 requires systematic experimental design:

  • Combinatorial mutagenesis approach:

    • Create a complete matrix of single and combined mutations

    • Include wildtype, single mutants, and double/multiple mutants

  • Functional characterization:

    • Measure multiple functional parameters (ATP hydrolysis, ion transport, CTS binding)

    • Quantify IC50 values for CTS sensitivity for each construct

  • Statistical analysis:

    • Use two-way ANOVA to detect statistically significant interaction terms

    • Linear regression models can quantify the magnitude of effects

  • Structural basis:

    • Complement functional studies with molecular modeling

    • Homology models based on high-affinity structures can predict interaction networks

Recent studies on ATP1A1 have demonstrated significant epistatic interactions between amino acid substitutions and insertions in the H1-H2 extracellular loop. Similar approaches can be applied to study ATP1B1-ATP1A1 interactions, where mutations in ATP1B1 might influence the effects of mutations in ATP1A1 and vice versa .

What molecular docking approaches are appropriate for studying ligand interactions with sheep ATP1B1-containing Na⁺/K⁺-ATPase?

For studying ligand interactions with sheep Na⁺/K⁺-ATPase complexes containing ATP1B1:

  • Software selection:

    • Autodock Vina 1.1.2 has been successfully used for Na⁺/K⁺-ATPase-ligand docking

    • PyMOL for visualization and analysis of docking results

  • Model preparation:

    • Start with a high-affinity structure of Na⁺/K⁺-ATPase (if no sheep structure is available, use homology modeling)

    • Include both ATP1A1 and ATP1B1 in the model, as both contribute to the binding pocket

    • Properly define the binding site grid to encompass known CTS binding residues

  • Analysis parameters:

    • Focus on hydrogen bond networks between ligand and protein

    • Analyze changes in binding affinity (docking scores)

    • Identify key residues in both subunits that contribute to binding

  • Validation approaches:

    • Compare docking scores with experimental IC50 values

    • Mutation studies to confirm the roles of predicted key residues

Molecular docking studies can reveal how amino acid changes in either ATP1A1 or ATP1B1 alter the interaction network with ligands such as ouabain, potentially explaining changes in experimental CTS resistance .

What are the most reliable methods for measuring the activity of recombinant sheep ATP1B1/ATP1A1 complexes?

Several established methods provide reliable measurement of Na⁺/K⁺-ATPase activity in recombinant systems:

MethodMeasurementAdvantagesLimitations
Colorimetric ATPase assayATP hydrolysis (Pi release)Direct measurement of enzymatic activityCannot distinguish between functional states
Rubidium uptakeIon transportMeasures complete transport cycleRequires radioactive isotopes
Ouabain bindingLigand affinityQuantifies IC50 valuesIndirect measure of function
ElectrophysiologyCurrent generationReal-time kineticsTechnically challenging

For comprehensive characterization:

  • ATP hydrolysis assay: Quantify the rate of ATP hydrolysis in the absence of CTS as a measure of native protein function

  • IC50 determination: Measure the molar concentration of CTS (e.g., ouabain) needed to reduce protein activity by 50%

  • Protein expression validation: Always verify expression levels by western blotting to normalize activity measurements

When interpreting results, consider that mutations in either subunit can affect multiple aspects of protein function, including CTS resistance, enzymatic activity, and membrane expression .

How can I distinguish between direct effects on ATP1B1 and indirect effects via ATP1A1 interaction?

Distinguishing direct from indirect effects requires multiple experimental approaches:

  • Domain swapping experiments:

    • Create chimeric constructs swapping domains between different species' ATP1B1

    • Compare effects on various functional parameters

  • Cross-species complementation:

    • Co-express sheep ATP1B1 with ATP1A1 from different species

    • Test whether species-specific functional properties are determined by ATP1B1 or ATP1A1

  • Site-directed crosslinking:

    • Introduce cysteine residues at potential interaction sites

    • Use crosslinking reagents to identify specific interaction residues

  • Binding kinetics assays:

    • Measure association and dissociation rates between ATP1B1 and ATP1A1

    • Compare wildtype with mutant proteins

  • Isolated domain studies:

    • Express and purify individual domains of ATP1B1

    • Test their ability to bind to ATP1A1 and influence its function

Through systematic application of these approaches, researchers can determine whether mutations in ATP1B1 directly affect its function or indirectly alter ATP1A1 activity through changed subunit interactions .

How can phylogenetic analysis inform functional studies of sheep ATP1B1?

Phylogenetic analysis provides critical context for functional studies:

  • Sequence conservation mapping:

    • Align ATP1B1 sequences across species to identify highly conserved residues

    • Highly conserved regions typically indicate functional importance

    • Residues under positive selection may indicate adaptation to specific environments

  • Methodological approach:

    • Collect ATP1B1 sequences from diverse species through public databases

    • Align using MAFFT in Geneious Prime or similar software

    • Construct maximum-likelihood trees using IQ-TREE with appropriate models

    • Apply ultrafast bootstrap replication (1,000+ replicates) for statistical support

  • Interpretation for functional studies:

    • Focus mutagenesis on residues showing interesting evolutionary patterns

    • Use ancestral state reconstruction to identify key evolutionary transitions

    • Examine co-evolution between ATP1B1 and ATP1A1 sites

  • Practical application:

    • When designing experiments, standardize residue numbering based on a reference sequence

    • Account for insertions/deletions when comparing across species

Phylogenetic analysis can reveal whether functional adaptations in ATP1B1 are lineage-specific or convergently evolved, guiding hypothesis generation for functional testing .

What structural modeling approaches best predict the effects of mutations in sheep ATP1B1?

For optimal structural prediction of mutation effects:

  • Homology modeling workflow:

    • Select high-resolution crystal structures as templates (Na⁺/K⁺-ATPase structures from PDB)

    • Generate models using MODELLER, SWISS-MODEL, or I-TASSER

    • Refine models through energy minimization

    • Validate using PROCHECK, VERIFY3D, or similar tools

  • Mutation effect prediction:

    • Model each mutation individually in the context of the ATP1A1/ATP1B1 complex

    • Analyze changes in:

      • Hydrogen bond networks

      • Electrostatic interactions

      • Van der Waals contacts

      • Conformational stability

  • Molecular dynamics simulations:

    • Run 100+ nanosecond simulations in explicit solvent

    • Analyze conformational changes over time

    • Quantify effects on protein stability and flexibility

  • Integration with experimental data:

    • Compare predicted structural changes with experimental functional data

    • Iteratively refine models based on experimental validation

Molecular modeling can predict how mutations alter specific interactions between ATP1B1 and ATP1A1 or between the complex and ligands like cardiotonic steroids, guiding the design of confirmatory experiments .

What are common pitfalls in expressing recombinant sheep ATP1B1 and how can they be addressed?

Common expression challenges and solutions include:

ChallengePossible CauseSolution
Low expression levelsSuboptimal codon usageCodon-optimize for expression host
Inclusion body formationImproper foldingLower expression temperature; co-express with chaperones
No detectable activityATP1A1 mismatchEnsure compatible ATP1A1 co-expression
Degradation productsProteolytic activityAdd protease inhibitors; modify purification protocol
Variable glycosylationExpression system differencesUse insect or mammalian cells for native-like glycosylation

Key recommendations:

  • Optimize vector design:

    • Use dual expression vectors (e.g., pFastBac Dual) for coordinated expression of both subunits

    • Place ATP1B1 under the p10 promoter and ATP1A1 under the PPH promoter for optimal expression ratio

  • Validation steps:

    • Confirm plasmid sequences before protein expression

    • Use restriction enzyme analysis and sequencing to verify construct integrity

    • Test multiple expression conditions with small-scale pilot experiments

  • Activity optimization:

    • Ensure proper co-expression of ATP1B1 with its corresponding ATP1A1 partner

    • Monitor both protein expression and functional activity in parallel

When troubleshooting, consider that ATP1B1 and ATP1A1 have co-dependent folding and assembly, so issues with one subunit can affect the expression and function of the entire complex .

How can contradictory functional data for ATP1B1 mutations be reconciled?

When facing contradictory results:

  • Systematic technical analysis:

    • Compare expression systems used (bacterial, insect, mammalian)

    • Assess differences in assay conditions (buffer composition, temperature, pH)

    • Evaluate normalization methods for protein expression levels

  • Context-dependent effects:

    • Consider the ATP1A isoform used for co-expression

    • Examine species-specific differences in the ATP1A/ATP1B1 interaction

    • Assess the influence of post-translational modifications

  • Epistatic interactions:

    • Test whether background mutations influence the effect of the mutation of interest

    • Create combinatorial mutations to detect non-additive effects

  • Comprehensive functional analysis:

    • Measure multiple functional parameters (ATP hydrolysis, ion transport, CTS binding)

    • Quantify both maximal activity and sensitivity to inhibitors

  • Statistical reassessment:

    • Increase biological replicates to improve statistical power

    • Use appropriate statistical tests to evaluate significance of differences

Recent research has shown that epistatic interactions can create seemingly contradictory results, as mutations can have dramatically different effects depending on the presence of other amino acid changes or insertions in the protein .

What statistical approaches are most appropriate for analyzing ATP1B1 functional data?

For robust analysis of ATP1B1 functional data:

  • Enzyme kinetics analysis:

    • Use non-linear regression to fit enzyme kinetic models

    • Calculate and compare kinetic parameters (Km, Vmax, kcat)

    • Apply Michaelis-Menten or Hill equations as appropriate

  • IC50 determination:

    • Fit dose-response curves using four-parameter logistic regression

    • Calculate 95% confidence intervals for IC50 values

    • Use these values for statistical comparisons between constructs

  • Statistical testing:

    • For comparing two conditions: t-test or Mann-Whitney U test (non-parametric)

    • For multiple comparisons: ANOVA with appropriate post-hoc tests (Tukey, Bonferroni)

    • For testing interactions: two-way ANOVA with interaction terms

  • Sample size considerations:

    • Minimum of 3-4 biological replicates for preliminary screening

    • 8-10 replicates for definitive studies

    • Power analysis to determine appropriate sample size

  • Visualization approaches:

    • Box plots for distribution of values

    • Bar graphs with error bars for mean comparisons

    • Scatter plots to show individual data points

When analyzing epistatic interactions, two-way ANOVA with interaction terms (as shown in the referenced study with F1,8 = 145.4, P = 2e−6) can robustly detect non-additive effects between mutations .

How can molecular modeling data be integrated with functional experimental results?

For effective integration of modeling and experimental data:

  • Correlation analysis:

    • Plot predicted binding energies against experimental IC50 values

    • Calculate Pearson or Spearman correlation coefficients

    • Test statistical significance of correlations

  • Structure-activity relationships:

    • Map functional data onto structural models

    • Identify structural features that correlate with functional changes

    • Use clustering algorithms to group mutations with similar effects

  • Hypothesis validation cycle:

    • Generate structural predictions from models

    • Test predictions with targeted mutations

    • Refine models based on experimental results

    • Repeat with new predictions

  • Combined visualization approaches:

    • Create integrated figures showing both structural predictions and experimental data

    • Use color coding to represent functional parameters on structural models

    • Present interaction networks with experimental validation

  • Machine learning integration:

    • Train predictive models using both structural features and experimental data

    • Use these models to predict effects of untested mutations

    • Validate predictions with new experiments

In published studies, molecular docking simulations successfully predicted the trend in resistance conferred by specific mutations, showing how modeling can guide and explain experimental findings .

How can sheep ATP1B1 research inform drug development targeting Na⁺/K⁺-ATPase?

ATP1B1 research provides valuable insights for drug development:

  • Target site identification:

    • Map interaction sites between beta subunit and cardiotonic steroids

    • Identify species-specific differences that affect drug binding

    • Exploit these differences to design more selective compounds

  • Resistance mechanism understanding:

    • Characterize how mutations in ATP1B1 influence drug resistance

    • Design drugs that maintain efficacy despite resistance mutations

    • Develop combination approaches targeting multiple sites

  • Allosteric modulation:

    • Identify beta-subunit specific binding sites

    • Design compounds that modulate activity through ATP1B1 interaction

    • Target the alpha-beta interface for novel therapeutic approaches

  • Experimental design approaches:

    • Use site-directed mutagenesis to create "humanized" sheep models

    • Test compound efficacy across species variants

    • Employ comparative analysis to predict clinical translation

  • Translational considerations:

    • Account for species variations when extrapolating to human applications

    • Use evolutionary analysis to identify conserved drug targets

    • Consider tissue-specific isoform expression patterns

Understanding the structural and functional relationships between ATP1B1 and ATP1A1 can guide the development of more selective Na⁺/K⁺-ATPase-targeting drugs with improved therapeutic profiles .

What are the most promising approaches for studying ATP1B1-specific effects independent of ATP1A1?

For isolating ATP1B1-specific effects:

  • Domain-specific studies:

    • Express and purify individual domains of ATP1B1

    • Study their interactions with ATP1A1 and other partners

    • Characterize their structural properties independently

  • Isoform-swapping experiments:

    • Create chimeric constructs with ATP1B1 domains from different isoforms

    • Identify isoform-specific functions

    • Test with multiple ATP1A isoforms to detect specificity

  • Interactome analysis:

    • Perform pull-down experiments with tagged ATP1B1

    • Identify interaction partners beyond ATP1A

    • Validate these interactions through co-immunoprecipitation

  • Tissue-specific expression studies:

    • Compare ATP1B1 expression patterns across tissues

    • Correlate with function in different cellular contexts

    • Identify tissues with high ATP1B1:ATP1A ratios for studying excess beta effects

  • Advanced microscopy approaches:

    • Use super-resolution techniques to study ATP1B1 localization

    • Perform FRET analysis to measure protein-protein interactions

    • Apply single-molecule tracking to study dynamics

These approaches can help distinguish the direct contributions of ATP1B1 to Na⁺/K⁺-ATPase function from its indirect effects through ATP1A1 modulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.