Recombinant Sheep Solute carrier family 25 member 38 (SLC25A38)

Shipped with Ice Packs
In Stock

Description

3.1. Hematologic Disease Studies

  • Leukemia Biomarker: Overexpressed in acute lymphoblastic leukemia (ALL), with 5.3-fold higher expression in patient samples compared to healthy controls . Expression correlates with blast cell abundance (r = 0.408, p = 0.025) .

  • Therapeutic Target: Knockdown models show rescued heme synthesis with glycine/folate supplementation .

3.2. Mitochondrial Metabolism

  • Vitamin B6 Dependency: Essential for mitochondrial pyridoxal 5'-phosphate (PLP) accumulation; loss reduces PLP levels by 70% .

  • Heme Biosynthesis: Critical for erythroid differentiation; zebrafish morphants exhibit anemia reversible via glycine .

Comparative Analysis of Recombinant SLC25A38 Variants

SpeciesTagExpression SystemKey ApplicationReference
HumanGST, His-FcHEK293Apoptosis assays
BovineHisE. coliStructural studies
RatHis-Fc-AviCHO cellsProtein interaction
MouseHis-Fc-AviHEK293In vivo imaging

Clinical Relevance

  • Congenital Sideroblastic Anemia (CSA): Loss-of-function mutations (e.g., p.Arg134Cys) impair glycine transport, causing heme deficiency .

  • Therapeutic Strategies: P2 receptor antagonists restore heme content by 60% in SLC25A38-deficient models .

Technical Considerations

  • Reconstitution: Use deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Activity Assays: Validate via mitochondrial PLP quantification or glycine uptake assays .

References

  1. Recombinant Full-Length Sheep SLC25A38 (Creative Biomart, 2025)

  2. Anti-SLC25A38 Antibody (St John’s Labs, 2025)

  3. Differential Expression in ALL (Indian J Med Biochem, 2021)

  4. Overexpression in Leukemia (PMC3997699, 2014)

  5. Glycine Transport Role (PLOS Genetics, 2016)

  6. Mitochondrial PLP Transport (Nature, 2025)

  7. CSA Therapeutic Rescue (PubMed, 2024)

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly specify them during order placement, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A38; Mitochondrial glycine transporter; Solute carrier family 25 member 38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
Full length protein
Species
Ovis aries (Sheep)
Target Names
SLC25A38
Target Protein Sequence
MIQKSRPALLQHQDVGDRVETLMLQPVIKAFLCGSISGTCSTVLFQPLDLLKTRLQTLQP SAHGSRRVGMLALLLTVVRTESLLGLWKGMSPSIVRCVPGVGIYFGTLYSLKQYFLRGHP PTALESVILGAGSRSVAGVCMSPITVIKTRYESGRYGYQSIYAALRSICHSEGFRGLFSG LTATLLRDAPFSGIYLMFYSQTKNVVLHSTDQLDAVLVPVVNFSCGIFAGILASLVTQPA DVIKTHMQLSPVKFRWIGQSVTLIFKDYGLRGFFQGSVPRALRRTLVAAMAWTVYEEMMA KMGLKS
Uniprot No.

Target Background

Function
Recombinant Sheep Solute carrier family 25 member 38 (SLC25A38) is a mitochondrial glycine transporter that facilitates the import of glycine into the mitochondrial matrix. It plays a crucial role in providing glycine for the initial enzymatic step in heme biosynthesis, the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) within the mitochondrial matrix. This transporter is essential during erythropoiesis.
Database Links

KEGG: oas:100147784

UniGene: Oar.6208

Protein Families
Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SLC25A38 and what is its function in sheep?

SLC25A38 belongs to the mitochondrial carrier family of proteins responsible for the exchange of metabolites, cofactors, and nucleotides between mitochondria and cytoplasm. In sheep, as in humans, SLC25A38 functions as a mitochondrial glycine transporter. The protein plays a critical role in heme biosynthesis by facilitating glycine transport into mitochondria, where it combines with succinyl-CoA to form δ-aminolevulinic acid (ALA), a rate-limiting step in heme synthesis.

Defects in this protein can lead to congenital sideroblastic anemia (CSA), characterized by microcytic, hypochromic anemia with iron overload. Studies have shown that patients with SLC25A38 mutations present at a young age (median 6 months) with severe anemia requiring transfusion support and iron chelation .

Methodologically, functional characterization of sheep SLC25A38 can be performed using radioisotope-labeled glycine uptake assays in isolated mitochondria or reconstituted liposomes containing the purified recombinant protein.

How does sheep SLC25A38 compare to human SLC25A38 in terms of sequence homology and function?

While the search results don't provide specific sequence homology data between sheep and human SLC25A38, we can make comparisons based on available data for other mitochondrial carriers. Mitochondrial carriers generally show high conservation across mammalian species, with sequence homologies typically ranging from 70-90% between human and other mammals.

For context, mitochondrial carriers such as the ADP/ATP carriers (AAC/ANT) show sequence homology of approximately 70-80% between human and Drosophila proteins . Given the closer evolutionary relationship between sheep and humans, we would expect even higher conservation for SLC25A38.

Functionally, both sheep and human SLC25A38 serve as mitochondrial glycine transporters, though subtle species-specific differences might exist in transport kinetics, substrate specificity, or regulatory mechanisms.

To assess functional equivalence experimentally, complementation assays can be performed where recombinant sheep SLC25A38 is expressed in human cell lines with knocked-out endogenous SLC25A38, measuring restoration of glycine transport and heme synthesis.

What are the recommended protocols for cloning sheep SLC25A38 cDNA from tissue samples?

For cloning sheep SLC25A38 cDNA, I recommend the following methodological approach:

  • Tissue selection: Liver or bone marrow samples are ideal sources due to high heme synthesis activity. If these are unavailable, blood cells (reticulocytes) can be used.

  • RNA extraction: Use TRIzol reagent followed by DNase I treatment to eliminate genomic DNA contamination. Assess RNA quality using spectrophotometry (A260/A280 ratio ≥1.8) and gel electrophoresis.

  • cDNA synthesis: Perform reverse transcription using oligo(dT) primers or random hexamers with a high-fidelity reverse transcriptase like SuperScript IV.

  • PCR amplification: Design primers based on the predicted sheep SLC25A38 sequence, including appropriate restriction sites for subsequent cloning. Include 15-20 bp overhangs complementary to your expression vector for Gibson Assembly if preferred over restriction cloning.

  • Cloning verification: Sequence multiple clones to identify potential PCR-induced errors and to confirm the correct reading frame.

For challenging templates with high GC content, consider adding DMSO (5-10%) to your PCR reaction and using a two-step PCR approach with a higher annealing/extension temperature.

What expression systems are most suitable for producing recombinant sheep SLC25A38?

The choice of expression system for recombinant sheep SLC25A38 should consider the protein's mitochondrial membrane localization and potential post-translational modifications. Several systems can be considered:

  • Bacterial expression (E. coli): While cost-effective, bacterial systems often struggle with properly folding membrane proteins. If pursuing this route, use specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression. Fusion tags (MBP, SUMO) can improve solubility.

  • Yeast systems (P. pastoris, S. cerevisiae): These provide a eukaryotic environment with proper protein folding machinery and can grow to high densities. S. cerevisiae is particularly valuable as it can complement SLC25A38 mutants for functional studies.

  • Insect cell systems (Sf9, Sf21, Hi5): These offer better post-translational modifications and membrane protein processing, using baculovirus expression vectors.

  • Mammalian cell lines (HEK293, CHO): Optimal for maintaining native conformation and post-translational modifications, though at higher cost and lower yield.

For functional studies, I recommend mammalian or yeast expression systems, while structural studies may benefit from the higher yields of insect cell systems with optimized constructs.

How can I design primers for PCR amplification of sheep SLC25A38?

Designing effective primers for sheep SLC25A38 amplification requires attention to several parameters:

  • Primer length: Aim for 18-25 nucleotides for the gene-specific portion.

  • GC content: Target 40-60% with no poly-G or poly-C stretches.

  • Melting temperature (Tm): Design primers with similar Tm values (within 2-3°C of each other), typically between 55-65°C.

  • Specificity: Check for potential cross-reactivity with other genes using BLAST.

  • Secondary structure: Avoid primers that form hairpins or primer-dimers.

For cloning the full-length coding sequence, design primers that include:

  • 5' primer: Start codon (ATG) plus 18-20 bp downstream

  • 3' primer: Reverse complement of stop codon and 18-20 bp upstream

Include appropriate restriction sites with 3-6 bp overhangs at the 5' ends for directional cloning, or 15-20 bp overlaps with the destination vector for Gibson Assembly.

For real-time PCR applications, design primers spanning exon-exon junctions to prevent genomic DNA amplification, with amplicon sizes of 70-200 bp.

How can I optimize purification protocols for recombinant sheep SLC25A38 to maintain its functional integrity?

Purifying functional recombinant SLC25A38 requires specialized approaches due to its membrane protein nature:

  • Membrane extraction: Use mild detergents for initial solubilization. Start with a panel including DDM (n-dodecyl-β-D-maltoside), LMNG (lauryl maltose neopentyl glycol), or digitonin at concentrations just above their critical micelle concentration (CMC).

  • Affinity purification: Utilize a tandem purification approach with:

    • Initial IMAC (immobilized metal affinity chromatography) using His6-tag

    • Second affinity step with a different tag (FLAG, Strep-II) for higher purity

  • Buffer optimization: Include stabilizing agents:

    • Glycerol (10-20%)

    • Reducing agents (2-5 mM β-mercaptoethanol or 1-2 mM DTT)

    • Lipid additives (0.1-0.2 mg/ml cholesterol hemisuccinate or E. coli lipid extract)

    • Substrate (glycine, 1-5 mM) to stabilize native conformation

  • Size exclusion chromatography: Remove aggregates and ensure homogeneity using a final SEC step with Superdex 200 or similar.

  • Functional assessment: Verify activity using:

    • Glycine transport assays in proteoliposomes

    • Thermal shift assays to confirm proper folding

    • Circular dichroism to assess secondary structure

For structural studies, consider protein reconstitution into nanodiscs or amphipols which better mimic the native membrane environment than detergent micelles.

What functional assays are available to test the glycine transport activity of recombinant sheep SLC25A38 in vitro?

Several complementary approaches can assess the glycine transport activity of purified recombinant sheep SLC25A38:

  • Radioisotope-based transport assays:

    • Reconstitute purified SLC25A38 into liposomes

    • Initiate transport by adding [14C]- or [3H]-labeled glycine

    • Terminate transport at defined time points using rapid filtration

    • Quantify internal radioactivity via scintillation counting

    • Include controls with uncouplers (CCCP) to demonstrate membrane potential dependency

  • Fluorescence-based methods:

    • FRET-based sensors that change conformation upon glycine binding

    • pH-sensitive fluorescent dyes to detect proton co-transport

    • Tryptophan fluorescence quenching to monitor conformational changes during transport

  • Electrophysiological measurements:

    • Patch-clamp recordings of SLC25A38 reconstituted into giant liposomes

    • Solid-supported membrane electrophysiology to detect charge movements

  • Complementation assays:

    • Express sheep SLC25A38 in yeast strains lacking endogenous glycine transporters

    • Measure rescue of growth phenotypes or restoration of heme synthesis

  • Isothermal titration calorimetry (ITC):

    • Directly measure binding affinities for glycine and potential inhibitors

    • Determine thermodynamic parameters of substrate binding

When designing these assays, include appropriate controls like SLC25A38 variants with known mutations from CSA patients to serve as negative or partial function controls.

How can I assess the structural differences between wild-type and mutant sheep SLC25A38 proteins?

Investigating structural differences between wild-type and mutant SLC25A38 proteins requires multi-faceted approaches:

  • Computational modeling:

    • Homology modeling based on solved structures of other mitochondrial carriers

    • Molecular dynamics simulations to assess stability and conformational changes

    • In silico mutagenesis to predict effects of specific mutations on protein folding and substrate binding

  • Biophysical techniques:

    • Circular dichroism (CD) spectroscopy to assess secondary structure composition

    • Thermal denaturation studies to compare protein stability

    • Tryptophan fluorescence to monitor tertiary structure

    • Limited proteolysis to identify regions with altered accessibility

  • Structural biology approaches:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (cryo-EM) for high-resolution structure determination

    • NMR spectroscopy for dynamic studies of substrate binding

  • Cross-linking studies:

    • Chemical cross-linking coupled with mass spectrometry to map distances between residues

    • Site-directed spin labeling with EPR to measure distances between labeled sites

  • Binding assays:

    • Isothermal titration calorimetry to compare substrate binding affinities

    • Surface plasmon resonance to measure binding kinetics

These approaches can reveal how mutations like p.Arg187Gln affect protein structure, potentially disrupting substrate binding sites or destabilizing critical domains.

What are the challenges in creating a sheep model for SLC25A38-related congenital sideroblastic anemia?

Developing a sheep model for SLC25A38-related CSA presents several significant challenges:

  • Technical barriers:

    • Limited genomic resources compared to mice or rats

    • Lower efficiency of genetic manipulation techniques in large animals

    • Longer generation time (5 months gestation, 6-8 months to sexual maturity)

    • Higher costs for housing and maintenance compared to rodent models

  • Scientific considerations:

    • Potential embryonic lethality of complete SLC25A38 knockout

    • Need to reproduce specific mutations observed in human patients (e.g., p.Arg187Gln)

    • Potential species differences in heme biosynthesis pathways

    • Difficulty in establishing genotype-phenotype correlations

  • Ethical and regulatory challenges:

    • More stringent ethical oversight for large animal models

    • Need to minimize animal numbers while obtaining statistically meaningful results

    • Requirements for specialized veterinary care and monitoring

  • Methodological approaches to overcome challenges:

    • Use CRISPR/Cas9 with ovine oocytes and somatic cell nuclear transfer

    • Consider mosaic or conditional knockout approaches if complete knockout is lethal

    • Develop heterozygous models first to evaluate dosage effects

    • Implement careful phenotyping protocols including hematological parameters, bone marrow analysis, and iron studies

Despite these challenges, a sheep model would offer advantages over rodent models, including physiological similarities to humans, comparable body size allowing for repeated sampling, and potential for testing therapeutic interventions like HSCT, which has shown efficacy in human patients .

How can CRISPR/Cas9 technology be used to introduce specific mutations in sheep SLC25A38 for functional studies?

CRISPR/Cas9 technology offers a powerful approach for generating precise mutations in sheep SLC25A38. Here's a comprehensive methodological workflow:

  • sgRNA design and validation:

    • Design 3-5 sgRNAs targeting the region of interest using tools like CRISPOR or CHOPCHOP

    • Test sgRNA efficiency in sheep fibroblasts using T7 endonuclease assay or Sanger sequencing

    • Select sgRNAs with >30% editing efficiency and minimal off-target potential

  • Donor template design:

    • For point mutations (e.g., equivalent to human p.Arg187Gln) , create ssODN templates (90-120 nt) with:

      • Desired mutation centrally located

      • Silent mutations to prevent re-cutting

      • At least 40-50 nt homology arms on each side

    • For larger modifications, use double-stranded DNA donors with 800+ bp homology arms

  • Delivery methods:

    • In vitro approach: Transfect sheep fibroblasts, screen for edits, then perform somatic cell nuclear transfer (SCNT)

    • Zygote approach: Microinject CRISPR components into pronuclear-stage embryos followed by embryo transfer

  • Verification strategies:

    • Genomic PCR and Sanger sequencing

    • Digital droplet PCR for precise quantification of editing efficiency

    • Whole genome sequencing to check for off-target effects

    • RT-PCR and Western blotting to confirm expression

  • Phenotypic characterization:

    • Complete blood counts to assess anemia

    • Bone marrow analysis for ring sideroblasts

    • Iron studies (serum iron, ferritin, transferrin saturation)

    • Functional assays measuring glycine transport and heme synthesis

This approach can generate valuable models to study the phenotypic consequences of specific SLC25A38 mutations and test potential therapeutic interventions like pyridoxine supplementation or HSCT, which have shown varying efficacy in human patients .

Table: Comparison of Mitochondrial Carrier Proteins in Humans and Model Organisms

Human Gene NameProtein FunctionDisease AssociationSheep Homology (est.)Mouse PhenotypeNotable Variations
SLC25A38Mitochondrial glycine transporterCongenital sideroblastic anemia85-90%Anemia with ring sideroblastsp.Arg187Gln identified in human patients
SLC25A1Citrate, isocitrate, malate transporterCombined D-2- and L-2-hydroxyglutaric aciduria~80%Embryonic lethal (knockout)61% homology to Drosophila ortholog
SLC25A4-6ADP/ATP carriersMitochondrial myopathy, cardiomyopathy85-95%Cardiac hypertrophy, exercise intolerance70-80% homology to Drosophila orthologs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.