Recombinant Sheep Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD)

Shipped with Ice Packs
In Stock

Description

Overview and Molecular Function

Recombinant Sheep SDHD is a genetically engineered form of the succinate dehydrogenase complex subunit D, produced to study its structural and functional roles in mitochondrial energy metabolism. This transmembrane protein anchors the succinate dehydrogenase (SDH) complex (Complex II) to the inner mitochondrial membrane, facilitating electron transfer from succinate to ubiquinone during the citric acid cycle and oxidative phosphorylation .

Key functional attributes include:

  • Ubiquinone Binding: SDHD interacts with ubiquinone via hydrogen bonds (e.g., Tyr83) to stabilize its orientation during electron transport .

  • Disease Linkages: Defective SDHD is associated with mitochondrial disorders and tumors such as paragangliomas due to dysregulated hypoxia signaling .

Recombinant Production and Expression Systems

Recombinant Sheep SDHD is synthesized using in vitro expression systems, primarily Escherichia coli, to ensure high yield and purity . Key variants include full-length and partial constructs, with optional tags (e.g., His, Fc) for purification or detection .

Table 1: Recombinant Sheep SDHD Products

Product CodeExpression SystemTagApplication
CSB-CF682918SHE. coliNon-taggedStructural studies
CSB-EP682918SH1-BMammalian cellsBiotinylatedProtein interaction assays

Data sourced from CUSABIO .

Functional Characterization and Enzyme Activity

Studies using hybrid SDH complexes (e.g., yeast and bacterial paralogs) reveal critical insights into recombinant SDHD's catalytic efficiency :

Table 2: Catalytic Activity of Recombinant SDH Hybrids

StrainCytochrome c Reductase Activity (% Wild Type)Decylubiquinone Reductase Activity (% Wild Type)
Wild Type (SDH3/SDH4)100%100%
SHH3 Hybrid68%57%
SHH4 Hybrid30%23%

Hybrid enzymes containing recombinant SDHD analogs exhibit reduced but measurable activity, highlighting its role in electron transport . Thermal denaturation assays further show that recombinant SDHD-containing complexes are less stable than wild-type enzymes .

Research Applications

Recombinant Sheep SDHD is utilized in:

  • Mitochondrial Disorders: Models for SDH deficiency syndromes, such as Leigh syndrome, to study metabolic flux disruptions .

  • Cancer Research: Investigating pseudohypoxic drive in tumors linked to SDHD mutations .

  • Structural Biology: Mapping ubiquinone-binding sites and heme interactions in Complex II .

Multi-Omic Integration and Database Resources

The OVT73 transgenic sheep model (expressing mutant HTT) includes SDHD-related metabolomic and proteomic datasets, enabling systems-level analysis of mitochondrial dysfunction in Huntington’s disease . Public databases (e.g., HD Sheep Database) provide interactive tools for correlating SDHD expression with neurological or metabolic phenotypes .

Challenges and Future Directions

  • Thermal Stability: Engineered SDHD shows reduced resilience to denaturation, necessitating optimizations in expression conditions .

  • Species-Specific Variations: Functional differences between sheep and human SDHD require careful interpretation in translational studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SDHD; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; CybS; CII-4; QPs3; Succinate dehydrogenase complex subunit D; Succinate-ubiquinone oxidoreductase cytochrome b small subunit; Succinate-ubiquinone reductase membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
56-158
Protein Length
Full Length of Mature Protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
SGSKAASLHWTGERVVSVLLLGLIPAAYLNPCSAMDYSLAATLTLHSHWGIGQVVTDYVH GDAVQKAAKTGLLVLSAFTFAGLCYFNYHDVGICKAVAMLWKL
Uniprot No.

Target Background

Function

Membrane-anchoring subunit of succinate dehydrogenase (SDH), a component of mitochondrial complex II in the electron transport chain. It facilitates electron transfer from succinate to ubiquinone (coenzyme Q).

Database Links

KEGG: oas:780442

UniGene: Oar.12987

Protein Families
CybS family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of SDHD in sheep mitochondria?

SDHD (Succinate dehydrogenase [ubiquinone] cytochrome b small subunit) is one of four proteins that constitute the succinate dehydrogenase (SDH) complex in the mitochondrial inner membrane. This complex plays a crucial role in both the tricarboxylic acid cycle and the electron transport chain. The specific function of SDHD is to anchor the complex to the mitochondrial membrane and facilitate electron transfer from succinate to ubiquinone in the respiratory chain .

Methodologically, researchers can verify SDHD function through:

  • Enzyme activity assays measuring succinate oxidation rates

  • Complex II-driven oxygen consumption measurements in isolated mitochondria

  • Membrane potential assessments before and after succinate addition

How does sheep SDHD structurally compare to SDHD in other species?

Sheep SDHD shares significant homology with SDHD from other mammalian species, particularly in the conserved regions essential for heme binding and interaction with other SDH subunits. While the complete sequence comparison data for sheep SDHD is limited, functional domains typically show >85% conservation across mammals.

For researchers conducting comparative studies, it is recommended to:

  • Perform multiple sequence alignments using CLUSTAL Omega or similar tools

  • Generate phylogenetic trees to visualize evolutionary relationships

  • Conduct structural modeling using Swiss-Model or AlphaFold2 to predict sheep-specific structural features

What are the optimal conditions for expressing recombinant sheep SDHD protein?

Expression of functional recombinant sheep SDHD presents unique challenges due to its hydrophobic nature and requirement for proper mitochondrial targeting.

Recommended Expression Systems:

Expression SystemAdvantagesLimitationsYield (mg/L)
E. coli BL21(DE3) with pET vectorsHigh yield, cost-effectiveLacks post-translational modifications1-3
Insect cells (Sf9) with baculovirusBetter folding, some PTMsModerate cost, longer production time2-5
Mammalian cells (CHO, HEK293)Native-like folding and PTMsHigher cost, lower yield0.5-2

Methodological considerations:

  • Include a cleavable N-terminal tag (His6 or GST) to facilitate purification

  • Co-express with chaperones (GroEL/ES) when using bacterial systems

  • For functional studies, consider co-expression with other SDH subunits

  • Optimize induction conditions (temperature: 16-18°C, IPTG: 0.1-0.5 mM) for bacterial expression

What detection methods are most effective for sheep SDHD in tissue samples?

Multiple detection approaches can be employed depending on the research question:

  • Western Blotting: A 1:1,000 dilution of anti-SDHD antibody effectively detects SDHD in various cell lysates. The expected molecular weight for sheep SDHD is approximately 17 kDa .

  • Immunohistochemistry: For tissue sections, use a 1:100 dilution of anti-SDHD antibody with antigen retrieval in citrate buffer (pH 6.0). This approach allows visualization of SDHD distribution within tissues .

  • Flow Cytometry: For cellular studies, approximately 0.1 μg antibody per one million cells can detect SDHD in permeabilized cells .

  • Mass Spectrometry: For unbiased detection, targeted LC-MS/MS approaches using multiple reaction monitoring (MRM) can quantify sheep SDHD peptides with high sensitivity.

How can CRISPR/Cas9 be applied to study SDHD function in sheep models?

CRISPR/Cas9 gene editing offers powerful approaches for investigating SDHD function through targeted modifications:

Methodological workflow:

  • Design stage:

    • Select target sequences in sheep SDHD gene using tools like CHOPCHOP or CRISPOR

    • Design sgRNAs with minimal off-target effects

    • Prepare homology-directed repair (HDR) templates for precise modifications

  • Delivery methods for sheep embryos:

    • Microinjection of CRISPR components into zygotes

    • Electroporation of sheep embryos

  • Verification approaches:

    • Deep sequencing to confirm modifications (efficiency ~30-40% based on similar applications)

    • Western blotting to assess protein expression

    • Functional assays to measure SDH activity

Based on similar gene editing studies in sheep, precise base substitution efficiency can reach ~31.6% when combining CRISPR/Cas9 with ssODN templates and SCR7 (a ligase IV inhibitor) . This approach allows creating defined mutations to study SDHD function without disrupting other sheep traits.

What are the challenges in integrating sheep SDHD data into multi-omic research frameworks?

Integrating SDHD data within multi-omic frameworks presents unique challenges:

  • Data normalization: Different data types (transcriptomic, proteomic, metabolomic) require specialized normalization approaches to enable cross-platform comparison.

  • Statistical considerations:

    • For small sample sizes (n=6 per group is common in sheep studies), use permutation tests and bootstrapping methods to assess significance

    • Apply differential correlation statistics to identify changes in regulatory networks

    • Calculate Z-statistics to determine significance of correlation structure changes between conditions

  • Computational integration strategies:

    • Principal Component Analysis (PCA) to visualize variance across multiple datasets

    • R-based analysis platforms (like those developed for HD sheep models) can be adapted for SDHD studies

    • Custom R packages (such as exCorr) can analyze differential correlation structures across conditions

  • Visualization approaches:

    • Integration of metabolic flux data with SDHD expression levels

    • Network analysis showing SDHD interactions within mitochondrial pathways

    • Heat maps of correlated variables across different tissues

How does SDHD dysfunction contribute to metabolic disorders in sheep models?

SDHD dysfunction has significant metabolic implications due to its central role in energy production:

  • Primary effects:

    • Decreased succinate oxidation

    • Reduced electron flow through complex II

    • Accumulation of succinate as a metabolic intermediate

  • Secondary consequences:

    • Altered reactive oxygen species (ROS) production

    • Metabolic reprogramming toward glycolytic pathways

    • Potential pseudohypoxic signaling due to succinate accumulation

Research approaches to study these effects include:

  • Metabolomic profiling of TCA cycle intermediates

  • Measurements of mitochondrial membrane potential

  • Respiratory capacity assessments in isolated mitochondria

  • Seahorse XF analysis of oxygen consumption rates

What genetic testing methods are most appropriate for identifying SDHD mutations in sheep populations?

Several testing approaches can be implemented for identifying SDHD variants in sheep:

  • PCR-RFLP analysis:

    • Amplify SDHD exonic regions

    • Digest with appropriate restriction enzymes to identify known mutations

    • Analyze fragment patterns on agarose gels

  • Sanger sequencing:

    • Direct sequencing of SDHD coding regions

    • Best for confirming suspected mutations in individual animals

  • Next-Generation Sequencing approaches:

    • Targeted sequencing panels including SDHD and related genes

    • Whole exome sequencing for comprehensive variant detection

    • Analysis pipeline should include sheep-specific reference sequences

  • High-resolution melting analysis:

    • Rapid screening method for detecting variants

    • Particularly useful for flock-wide surveillance

When implementing genetic testing programs, consider:

  • Appropriate sampling strategies for flock representation

  • Including positive and negative controls

  • Following up screening tests with confirmatory methods

  • Developing a database of identified variants for reference

What are the key considerations for designing co-immunoprecipitation experiments with sheep SDHD?

Co-immunoprecipitation (Co-IP) experiments are valuable for studying SDHD protein interactions:

Methodological workflow:

  • Sample preparation:

    • Fresh mitochondrial isolation from sheep tissues (preferably heart, liver, or skeletal muscle)

    • Gentle solubilization with digitonin (0.5-1%) or DDM (0.5-1%) to preserve protein complexes

    • Pre-clearing with protein A/G beads to reduce non-specific binding

  • Immunoprecipitation strategy:

    • Direct approach: Use anti-SDHD antibody (validated for sheep) at 1:50-1:100 dilution

    • Indirect approach: Express tagged SDHD and use tag-specific antibodies

    • Crosslinking consideration: Use DSP or formaldehyde (0.1-1%) for capturing transient interactions

  • Controls and validation:

    • Include IgG negative control

    • Perform reciprocal Co-IPs with antibodies against known interacting partners

    • Validate with alternative approaches (e.g., proximity ligation assay)

  • Detection methods:

    • Western blotting for known interactors

    • Mass spectrometry for unbiased identification of interacting proteins

How can multi-omic approaches be applied to understand SDHD regulation in sheep mitochondria?

Multi-omic integration provides comprehensive insights into SDHD regulation:

  • Transcriptomic analysis:

    • RNA-seq to identify transcriptional regulation of SDHD and related genes

    • Analysis of alternative splicing events affecting SDHD expression

    • Integration with ChIP-seq data to identify transcription factors regulating SDHD

  • Proteomic approaches:

    • Quantitative proteomics to measure SDHD abundance

    • Post-translational modification analysis by phosphoproteomics and other PTM enrichment strategies

    • Protein turnover studies using SILAC or similar labeling approaches

  • Metabolomic integration:

    • Targeted analysis of TCA cycle intermediates

    • Correlation of succinate/fumarate ratios with SDHD expression levels

    • Flux analysis using 13C-labeled substrates

  • Data integration framework:

    • Use R-based platforms for data normalization and integration

    • Apply differential correlation analysis to identify regulatory relationships

    • Implement bootstrap and permutation tests for robust statistical analysis with small sample sizes

Example integration workflow:

  • Generate datasets from the same animals at a single timepoint

  • Normalize each dataset independently

  • Integrate using unique sample identifiers across datasets

  • Perform correlation analysis between datasets

  • Visualize relationships using network analysis or heat maps

What are common pitfalls in sheep SDHD antibody validation and how can they be addressed?

Antibody validation is critical for reliable SDHD research:

  • Specificity issues:

    • Problem: Cross-reactivity with other proteins

    • Solution: Test antibody against SDHD knockout/knockdown samples

    • Solution: Perform peptide competition assays

  • Sensitivity limitations:

    • Problem: Low signal from native SDHD levels

    • Solution: Optimize antibody concentration (starting with 1:1,000 for Western blot)

    • Solution: Enhance signal using appropriate detection systems

  • Reproducibility challenges:

    • Problem: Batch-to-batch variation

    • Solution: Standardize positive controls across experiments

    • Solution: Test multiple antibody lots where possible

  • Application-specific validation:

    • Problem: Antibody works in one application but not another

    • Solution: Validate separately for each application (WB, IHC, Flow)

    • Solution: Optimize protocols for each application (e.g., 1:100 for IHC/ICC, 1:1,000 for WB)

Recommended validation workflow:

  • Test antibody against recombinant sheep SDHD protein

  • Verify specificity in sheep tissue lysates using appropriate controls

  • Document optimal conditions for each application

  • Maintain detailed protocols for reproducibility

How can researchers troubleshoot issues with recombinant sheep SDHD solubility and stability?

Recombinant SDHD often presents solubility and stability challenges:

Common issues and solutions:

ProblemPotential CausesSolutions
Inclusion body formationOverexpression, improper foldingLower induction temperature (16-18°C), reduce IPTG concentration, co-express with chaperones
Poor solubilityHydrophobic membrane domainsUse mild detergents (DDM, CHAPS, Triton X-100), test detergent screens
Protein degradationProtease activity, instabilityAdd protease inhibitors, maintain samples at 4°C, avoid freeze-thaw cycles
Loss of cofactorsHeme dissociation during purificationInclude stabilizing agents in buffers, consider gentle purification methods

Stability optimization approaches:

  • Buffer optimization: Test different pH values (6.5-8.0) and salt concentrations (100-300 mM NaCl)

  • Additive screening: Evaluate glycerol (5-20%), reducing agents (DTT, β-ME), and stabilizing agents

  • Storage conditions: Compare different temperatures (-80°C, -20°C, 4°C) and effects of lyophilization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.