Recombinant Sheep Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs
In Stock

Description

Introduction to ST7 Protein

ST7 (Suppressor of Tumorigenicity 7) is a transmembrane protein belonging to the low-density lipoprotein receptor (LDLR) superfamily, designated as LRP12 . While initially proposed as a tumor suppressor, its role in cancer remains ambiguous, with studies showing variable expression across malignancies . The recombinant sheep ST7 protein provides a tool for investigating its interactions with extracellular matrix components, signaling pathways, and potential therapeutic targets.

Table 1: Production Details

ParameterDetails
Expression SystemE. coli
Purity>90% (SDS-PAGE verified)
FormulationLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for storage
Storage-20°C/-80°C; avoid freeze-thaw cycles

Research Applications

Recombinant sheep ST7 is primarily used in:

  • ELISA: Detecting endogenous ST7 levels in biological samples .

  • Functional Studies: Investigating ligand-binding interactions (e.g., with LRPAP1) .

  • Cancer Research: Exploring its contradictory roles in tumor suppression vs. oncogenic signaling .

Table 2: ST7 in Cancer Studies

Study FocusFindingsSource
Mutation FrequencySomatic ST7 mutations are rare in colorectal, gastric, and liver cancers .
Expression VariabilityUpregulated in some cancers (e.g., prostate) but downregulated in others .
Pathway InteractionsCytoplasmic domain binds RACK1, MIBP, and SARA, implicating roles in signal transduction .

Limitations and Future Directions

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ST7; Suppressor of tumorigenicity 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Ovis aries (Sheep)
Target Names
ST7
Target Protein Sequence
MAEAGTGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDIFCSAELRDWNCESIFMRVEDELEIPPAPQSQHFQN
Uniprot No.

Target Background

Database Links

KEGG: oas:100126576

UniGene: Oar.22910

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Recombinant Sheep ST7 protein?

Recombinant Sheep Suppressor of Tumorigenicity 7 protein (ST7) is a full-length protein consisting of 585 amino acids (positions 1-585). The commercially available recombinant protein is typically fused to an N-terminal His tag and expressed in E. coli expression systems. The amino acid sequence is: MAEAGTGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDSDHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDDISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYLLEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKGHLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKAMIDIFCSAELRDWNCESIFMRVEDELEIPPAPQSQHFQN

How should Recombinant Sheep ST7 protein be stored and handled for optimal stability?

For optimal stability of Recombinant Sheep ST7 protein:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles, which significantly diminish protein activity

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended) for long-term storage

  • Store working aliquots at 4°C for up to one week

  • For reconstituted protein, briefly centrifuge the vial before opening to bring contents to the bottom

The protein is typically supplied in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during freeze-drying and storage .

What is the relationship between ST7 and tumor suppression?

ST7 was originally proposed to function as a tumor suppressor protein, but research has revealed a more complex relationship with cancer development. Unlike classic tumor suppressors, ST7 is not consistently downregulated across various cancer types through mutation or loss of heterozygosity. In fact, in certain cancers, ST7 expression may even be upregulated.

The tumor suppressive functions of ST7 appear to be context-dependent and may involve:

  • Modulation of extracellular matrix molecules involved in tissue remodeling (including SPARC, IGFBP5, and matrix metalloproteinases)

  • Regulation of in vivo tumorigenicity through mechanisms that have not been fully characterized

  • Potential interactions with signaling pathways that influence cell growth and survival

These findings suggest that ST7's role in cancer biology is more nuanced than initially thought and may depend on specific tissue environments and genetic contexts .

What methodological approaches are most effective for studying ST7 protein-protein interactions in ovine systems?

To effectively study ST7 protein-protein interactions in ovine systems, researchers should consider a multi-faceted approach:

  • Co-Immunoprecipitation (Co-IP) with Recombinant Protein:

    • Use anti-His tag antibodies to pull down His-tagged recombinant sheep ST7

    • Analyze interacting partners by mass spectrometry

    • Confirm interactions with reciprocal Co-IP using antibodies against putative partners

  • Proximity-Based Labeling:

    • Generate fusion constructs with BioID or TurboID ligated to ST7

    • Express in ovine cell lines or primary cells

    • Identify proximal proteins through streptavidin pulldown and mass spectrometry

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified recombinant sheep ST7 on sensor chips

    • Measure direct binding kinetics with potential interacting proteins

    • Determine binding constants (KD, kon, koff) for quantitative assessment

  • Yeast Two-Hybrid Screening:

    • Use the extracellular domain (containing CUB and LDLR domains) and cytoplasmic domain as separate baits

    • Screen against ovine cDNA libraries

    • Validate hits through orthogonal methods

When analyzing results, it's important to consider the transmembrane nature of ST7 and to distinguish between interactions occurring in the extracellular domain versus the cytoplasmic domain, as these may have distinct functional implications .

How can researchers distinguish between the functional effects of ST7 and the closely related LDLR family members in experimental models?

Distinguishing between ST7 and other LDLR family members requires methodological precision:

  • Domain-Specific Functional Analysis:

    • Generate chimeric proteins swapping domains between ST7 and other LDLR family members

    • Express these in appropriate cell lines to determine which domains confer specific functions

    • Use systematic mutagenesis of key residues unique to ST7 to identify critical functional sites

  • CRISPR/Cas9-Mediated Knockout and Rescue:

    • Create ST7-knockout cell lines using CRISPR/Cas9

    • Perform rescue experiments with either wild-type ST7 or other LDLR family members

    • Measure phenotypic outcomes to determine functional overlap or uniqueness

  • Selective Inhibition Strategies:

    • Develop domain-specific antibodies or nanobodies that selectively target ST7

    • Design peptide inhibitors that compete for binding with ST7-specific interaction partners

    • Utilize antisense oligonucleotides or siRNAs with demonstrated specificity for ST7

  • Differential Expression Analysis:

    • Perform RNA-seq on samples with ST7 overexpression or knockdown

    • Compare transcriptional profiles with those resulting from manipulation of other LDLR family members

    • Identify ST7-specific gene signatures that differentiate its function

When interpreting results, researchers should consider that while ST7 belongs to the LDLR superfamily, its function may be context-dependent and potentially distinct from canonical LDLR functions in lipid metabolism .

What are the current challenges in correlating in vitro findings with ST7 to in vivo phenotypes in sheep disease models?

Correlating in vitro ST7 findings with in vivo phenotypes in sheep disease models presents several methodological challenges:

  • Limited Genetic Manipulation Tools for Sheep:

    • Unlike mouse models, genetic manipulation in sheep is technically challenging and resource-intensive

    • CRISPR/Cas9 applications in sheep are advancing but still less efficient than in rodent models

    • Development of inducible or tissue-specific ST7 knockout sheep remains difficult

  • Phenotypic Assessment Complexities:

    • Sheep have longer lifespans than laboratory rodents, extending experimental timelines

    • Subtle phenotypic changes may require sophisticated imaging or physiological measurements

    • Heterogeneity in outbred sheep populations can mask ST7-specific effects

  • Tissue-Specific Expression Patterns:

    • ST7 is expressed in multiple tissues with highest levels in heart and skeletal muscle

    • Differential expression across tissues requires comprehensive sampling strategies

    • Temporal changes in expression during development or disease progression add complexity

  • Methodological Approaches to Address These Challenges:

    • Use of sheep-derived primary cells and organoids for preliminary validation

    • Ex vivo tissue explant cultures to bridge in vitro and in vivo studies

    • Local delivery of ST7-modulating agents (siRNA, overexpression vectors) to target tissues

    • Utilization of naturally occurring ST7 variants in sheep populations for association studies

Research has shown that retroviral elements can induce lung tumors in sheep, such as those caused by Jaagsiekte sheep retrovirus (JSRV). Understanding how ST7 functions in these pathological contexts could provide valuable insights into its potential tumor suppressor role in vivo .

What are the optimal conditions for expression and purification of recombinant sheep ST7 protein?

For optimal expression and purification of recombinant sheep ST7 protein:

  • Expression System Selection:

    • E. coli BL21(DE3) is commonly used for full-length ST7 expression with N-terminal His-tag

    • For complex post-translational modifications, consider mammalian expression systems (HEK293, CHO)

    • Baculovirus-insect cell systems may offer a compromise between bacterial and mammalian systems

  • Expression Optimization:

    • For E. coli: Induce at OD600 of 0.6-0.8 with 0.1-0.5 mM IPTG

    • Lower induction temperature (16-25°C) increases soluble protein yield

    • Extended expression time (18-24 hours) at lower temperatures improves folding

    • Consider co-expression with chaperones to enhance solubility

  • Purification Protocol:

    • Lyse cells in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Include protease inhibitors and 1-2% glycerol to maintain stability

    • Purify using Ni-NTA affinity chromatography with gradient elution (20-250 mM imidazole)

    • Follow with size exclusion chromatography to remove aggregates

    • Consider ion exchange chromatography as a polishing step

  • Quality Control Metrics:

    • Assess purity by SDS-PAGE (target >90%)

    • Verify identity by Western blot using anti-His and anti-ST7 antibodies

    • Confirm protein integrity by mass spectrometry

    • Evaluate proper folding using circular dichroism

The purified protein can be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, and lyophilization is recommended for long-term storage .

How can researchers effectively design experiments to investigate ST7's role in sheep disease models, particularly in relation to tumorigenesis?

To effectively investigate ST7's role in sheep disease models related to tumorigenesis:

  • Baseline Expression Profiling:

    • Quantify ST7 expression across different sheep tissues using qRT-PCR and immunohistochemistry

    • Compare expression levels between healthy tissues and naturally occurring tumors

    • Analyze correlation between ST7 expression and histopathological features

  • In Vitro Models:

    • Establish primary sheep cell lines from relevant tissues

    • Manipulate ST7 expression using lentiviral overexpression or knockdown

    • Assess impact on proliferation, apoptosis, migration, and colony formation

    • Measure changes in signaling pathways potentially regulated by ST7

  • Ex Vivo Approaches:

    • Utilize precision-cut tissue slices from sheep lungs or other organs

    • Treat with ST7-modulating agents and assess tumorigenic markers

    • Develop organoid cultures from sheep tissues with manipulated ST7 levels

  • In Vivo Strategies:

    • Local delivery of ST7-modulating agents to specific tissues

    • For lung cancer models, consider the relationship with Jaagsiekte sheep retrovirus (JSRV)

    • Use image-guided biopsies for longitudinal assessment of ST7-manipulated tissues

    • Monitor tumorigenesis using imaging technologies (CT, MRI, PET)

  • Experimental Readouts:

    • Histopathological assessment (tumor grade, invasiveness)

    • Molecular markers (proliferation, apoptosis, inflammation)

    • Transcriptomic and proteomic analysis of ST7-modulated tissues

    • Immunological parameters (tumor-infiltrating lymphocytes, cytokine profiles)

Research has demonstrated that JSRV causes contagious lung cancer in sheep, and studying the interaction between ST7 and viral oncogenesis pathways could provide valuable insights into ST7's function in tumor suppression .

What analytical techniques provide the most accurate assessment of recombinant sheep ST7 protein functionality?

For accurate assessment of recombinant sheep ST7 protein functionality:

  • Binding Assays:

    • Surface Plasmon Resonance (SPR) to measure direct interactions with potential binding partners

    • Enzyme-Linked Immunosorbent Assay (ELISA) for quantitative binding assessment

    • Fluorescence Anisotropy to measure interactions in solution

    • Bio-Layer Interferometry for real-time binding kinetics

  • Cellular Functional Assays:

    • Cell proliferation assays (MTT, BrdU incorporation) following ST7 treatment

    • Migration and invasion assays to assess impact on cell motility

    • Apoptosis assays (Annexin V staining, caspase activation) to evaluate cell death induction

    • Reporter gene assays for measuring ST7-mediated signaling pathway activation

  • Structural Analysis:

    • Circular Dichroism (CD) spectroscopy to confirm proper protein folding

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to identify structured domains

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) to analyze protein dynamics and conformational changes

  • Molecular Dynamics:

    • Fluorescence Resonance Energy Transfer (FRET) to measure protein-protein interactions

    • Single-molecule tracking to assess membrane dynamics of ST7

    • Co-localization studies using confocal microscopy

    • Receptor internalization assays to evaluate endocytosis

  • Downstream Signaling Analysis:

    • Phospho-specific Western blotting to detect activation of signaling molecules

    • Phospho-proteomics to identify global phosphorylation changes

    • Transcriptomics to assess gene expression changes following ST7 treatment

    • Metabolomics to evaluate metabolic alterations induced by ST7

When interpreting functional data, it's important to consider that ST7 may have context-dependent effects based on cell type and experimental conditions .

How does sheep ST7 compare structurally and functionally to human ST7 and other mammalian orthologs?

Sheep ST7 shares significant structural and functional similarities with human and other mammalian orthologs, with some notable differences:

The strong evolutionary conservation of ST7 across mammalian species suggests that findings from sheep models may have translational relevance to human health and disease.

What are the implications of genomic sequence variations in ST7 for interpreting experimental results across different sheep breeds?

Genomic sequence variations in ST7 across sheep breeds have important implications for experimental design and data interpretation:

  • Breed-Specific Polymorphisms:

    • Different sheep breeds may harbor single nucleotide polymorphisms (SNPs) in the ST7 gene

    • These polymorphisms could affect protein structure, stability, or interaction capabilities

    • Researchers should sequence ST7 from experimental animals to identify relevant variations

    • A comprehensive database of breed-specific ST7 variants would benefit comparative studies

  • Functional Consequences of Variations:

    • Coding region variations may alter amino acid sequence and protein function

    • Promoter region polymorphisms could affect expression levels

    • Intronic variations might influence splicing patterns, potentially generating different isoforms

    • Experimental designs should account for these variables when comparing across breeds

  • Experimental Control Strategies:

    • Use same-breed animals for comparative studies when possible

    • Include breed as a variable in statistical analyses

    • Sequence the ST7 gene in experimental animals to identify variants

    • Consider using CRISPR/Cas9 to standardize ST7 sequences across experimental groups

  • Interpretation Framework:

    • Establish baseline ST7 expression and function for each breed under study

    • Attribute phenotypic differences to ST7 variants only after controlling for genetic background

    • Consider epistatic interactions between ST7 variants and other genes

    • Develop breed-specific reference ranges for ST7-related parameters

  • Translational Considerations:

    • Determine which sheep breed's ST7 most closely resembles human ST7 for translational studies

    • Consider how breed-specific variations might limit extrapolation to human conditions

    • Use multivariable analysis to distinguish ST7-specific effects from breed effects

Understanding these variations is particularly important when studying diseases like Jaagsiekte sheep retrovirus (JSRV)-induced lung cancer, where genetic background might influence susceptibility and progression .

How should researchers interpret conflicting data regarding ST7's tumor suppressor function in different experimental systems?

When faced with conflicting data regarding ST7's tumor suppressor function across different experimental systems, researchers should implement the following interpretive framework:

  • Context-Dependent Effects Analysis:

    • ST7 was originally proposed as a tumor suppressor but is not consistently downregulated in cancers

    • In some cancers, ST7 expression may be upregulated rather than downregulated

    • Researchers should document the specific cellular context, tissue origin, and genetic background of each experimental system

    • Develop a matrix comparing experimental conditions with observed outcomes to identify patterns

  • Methodological Variables Assessment:

    • Different methods of manipulating ST7 (knockout, knockdown, overexpression) may yield different results

    • Duration of experiments may influence outcomes (acute vs. chronic effects)

    • In vitro vs. in vivo systems may show divergent results due to microenvironmental factors

    • Standardize methodological approaches across comparative studies when possible

  • Molecular Pathway Resolution:

    • ST7 may interact with different signaling pathways depending on cell type

    • Map ST7 interactions in each experimental system to identify divergent interaction partners

    • Document the status of key tumor suppressor and oncogenic pathways in each model

    • Consider that ST7 may have dual roles depending on which molecular partners are present

  • Isoform-Specific Analysis:

    • Genomic sequencing indicates the possibility of up to 18 splicing isoforms for human ST7

    • Different experimental systems may express different isoforms

    • Use isoform-specific detection methods (PCR primers, antibodies) to clarify which variants are present

    • Specific isoforms may have opposing functions in tumorigenesis

  • Integrated Data Interpretation:

    • Weigh evidence based on methodological rigor and reproducibility

    • Consider that apparent contradictions may reflect true biological complexity rather than experimental error

    • Develop models that accommodate context-dependent functions for ST7

    • Design experiments specifically aimed at resolving contradictions

Research has shown that ST7 expression may be associated with downregulated expression of extracellular matrix molecules involved in remodeling, such as SPARC, IGFBP5, and matrix metalloproteinases, suggesting its effects may depend on tissue architecture and remodeling status .

What emerging technologies hold the most promise for elucidating ST7's molecular mechanisms in ovine disease models?

Several emerging technologies show exceptional promise for advancing our understanding of ST7's molecular mechanisms in ovine disease models:

  • Single-Cell Technologies:

    • Single-cell RNA sequencing to map ST7 expression across heterogeneous cell populations in sheep tissues

    • Single-cell ATAC-seq to identify regulatory elements controlling ST7 expression

    • Single-cell proteomics to detect cell-specific ST7 protein levels and post-translational modifications

    • Integration of these datasets can reveal cell type-specific ST7 functions and regulatory networks

  • CRISPR-Based Technologies:

    • CRISPR activation (CRISPRa) and interference (CRISPRi) for precise modulation of ST7 expression

    • Base editing for introducing specific mutations without double-strand breaks

    • Prime editing for targeted sequence replacements to model ST7 variants

    • CRISPR screens to identify genes that synthetically interact with ST7

  • Spatial Biology Approaches:

    • Spatial transcriptomics to map ST7 expression patterns within tissue architecture

    • Multiplexed ion beam imaging (MIBI) to visualize ST7 protein in relation to multiple markers

    • Expansion microscopy combined with super-resolution imaging for nanoscale localization

    • These approaches can relate ST7 expression to specific microenvironmental features

  • Protein Structure and Interaction Technologies:

    • AlphaFold and RoseTTAFold for computational prediction of ST7 protein structure

    • Cryo-electron microscopy for experimental structure determination

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map protein dynamics

    • Crosslinking mass spectrometry (XL-MS) to identify protein interaction interfaces

  • Organoid and Advanced In Vitro Models:

    • Sheep-derived organoids to model tissue-specific ST7 functions

    • Bioprinted 3D tissues incorporating multiple cell types to study ST7 in complex environments

    • Organ-on-chip platforms to investigate ST7 under physiologically relevant conditions

    • These systems bridge the gap between simple cell culture and in vivo models

These technologies, particularly when used in combination, offer unprecedented opportunities to dissect ST7's role in normal physiology and disease processes in sheep models, potentially informing translational applications in human health .

How might researchers better integrate computational approaches with experimental data to predict ST7 functions and interactions?

To better integrate computational approaches with experimental data for ST7 research:

  • Multi-Omics Data Integration:

    • Develop computational pipelines that integrate transcriptomic, proteomic, and metabolomic data

    • Use machine learning algorithms to identify patterns across diverse datasets

    • Apply network analysis to place ST7 within functional pathways

    • Create visualization tools that present multi-dimensional data in interpretable formats

  • Structural Bioinformatics:

    • Utilize AlphaFold or similar tools to predict ST7 protein structure

    • Perform molecular dynamics simulations to understand protein flexibility and conformational changes

    • Use docking studies to predict interactions with potential binding partners

    • Develop models of membrane integration for this transmembrane protein

  • Systems Biology Approaches:

    • Create mathematical models of ST7-related signaling pathways

    • Perform in silico perturbation experiments to generate testable hypotheses

    • Use Bayesian networks to infer causal relationships between ST7 and other molecules

    • Develop agent-based models to simulate cell-cell interactions mediated by ST7

  • Comparative Genomics:

    • Analyze ST7 conservation across species to identify functionally important regions

    • Study syntenic regions to understand evolutionary conservation of regulatory elements

    • Compare ST7 variation within sheep populations to identify functional polymorphisms

    • Use evolutionary analysis to predict key functional residues

  • Integrated Workflow Implementation:

    • Begin with in silico predictions to guide experimental design

    • Use experimental data to refine computational models iteratively

    • Develop standardized data formats to facilitate sharing between computational and experimental researchers

    • Create accessible databases of ST7-related data for meta-analyses

  • Practical Implementation Strategy:

    • Start with structure prediction and conservation analysis

    • Design experiments to test computational predictions

    • Use experimental results to refine models

    • Apply refined models to predict novel functions or interactions

    • Validate with targeted experiments

By implementing this iterative approach between computational prediction and experimental validation, researchers can accelerate discovery and develop more comprehensive models of ST7 function .

What are the most promising translational applications of ST7 research from sheep models to human health and disease?

The translational potential of ST7 research from sheep models to human health presents several promising avenues:

  • Cancer Biology and Therapeutics:

    • ST7's proposed tumor suppressor function suggests applications in cancer treatment

    • Understanding how ST7 modulates extracellular matrix remodeling could inform anti-metastatic strategies

    • The high conservation (98% homology) between sheep and human ST7 in the extracellular domain supports translational relevance

    • Developing ST7-based biomarkers for cancer progression or therapeutic response

  • Pulmonary Disease Insights:

    • Jaagsiekte sheep retrovirus (JSRV) causes lung cancer in sheep with remarkable histological similarity to human lung adenocarcinoma

    • ST7's potential role in this process could illuminate mechanisms in human lung cancer

    • The bronchiolo-alveolar pattern of JSRV-induced tumors resembles human peripheral adenocarcinoma

    • These similarities provide a unique model for studying specific subtypes of human lung cancer

  • Inflammatory and Immune Regulation:

    • ST7 expression patterns in atopic dermatitis models may have relevance to human skin conditions

    • Understanding ST7's potential interaction with microbiome components could inform host-pathogen biology

    • ST7's widespread expression in tissues suggests broad immune regulatory functions

    • Therapeutic manipulation of ST7 pathways might modulate inflammatory responses

  • Comparative Disease Modeling:

    • Sheep models offer advantages in size, physiology, and translational relevance compared to rodent models

    • The outbred nature of sheep populations better reflects human genetic diversity

    • Sheep lifespans allow for studying longer-term disease progression

    • Findings from sheep may better predict human responses to ST7-targeting therapeutics

  • Specific Translational Applications:

    • Development of ST7-based diagnostic biomarkers

    • Design of peptide mimetics that modulate ST7 function

    • Therapeutic antibodies targeting ST7 or its pathways

    • Gene therapy approaches to restore normal ST7 function in disease contexts

The evolutionary conservation of ST7 between sheep and humans supports the translational value of ovine models, while the larger size and physiological similarities of sheep to humans provide advantages over traditional rodent models for certain applications .

What are common pitfalls in experiments using recombinant sheep ST7 protein, and how can researchers avoid them?

When working with recombinant sheep ST7 protein, researchers should be aware of these common pitfalls and their solutions:

  • Protein Aggregation Issues:

    • Pitfall: Recombinant ST7 may form aggregates, particularly after freeze-thaw cycles

    • Solution: Aliquot protein immediately after reconstitution to avoid repeated freeze-thaw

    • Solution: Add 6% trehalose or 5-50% glycerol to storage buffer

    • Solution: Use centrifugal filtration (0.22 μm) before experiments to remove aggregates

    • Verification: Run dynamic light scattering to confirm monodispersity

  • Degradation During Handling:

    • Pitfall: Proteolytic degradation during experimental procedures

    • Solution: Work at 4°C whenever possible

    • Solution: Add protease inhibitor cocktail to all buffers

    • Solution: Minimize exposure time during experimental procedures

    • Verification: Check protein integrity by SDS-PAGE before each experiment

  • Loss of Activity After Reconstitution:

    • Pitfall: Decreased functional activity after reconstitution from lyophilized state

    • Solution: Reconstitute slowly at 4°C with gentle mixing (no vortexing)

    • Solution: Use deionized sterile water and adjust buffer conditions afterward

    • Solution: Allow protein to recover at 4°C for 30 minutes after reconstitution

    • Verification: Include functional controls in each experiment to confirm activity

  • Non-Specific Binding in Assays:

    • Pitfall: High background in binding assays due to non-specific interactions

    • Solution: Include 0.05-0.1% BSA or 0.05% Tween-20 in binding buffers

    • Solution: Pre-block surfaces with 1-3% BSA before adding ST7

    • Solution: Include appropriate negative controls (irrelevant His-tagged protein)

    • Verification: Perform concentration-dependent binding studies to confirm specificity

  • Tag Interference with Function:

    • Pitfall: N-terminal His-tag affecting protein function or interactions

    • Solution: Consider using tag-removal enzymes (TEV protease) for critical experiments

    • Solution: Compare results with differently tagged versions of the protein

    • Solution: Design control experiments to assess tag effects

    • Verification: Test functional assays with both tagged and untagged protein when possible

  • Inappropriate Storage Conditions:

    • Pitfall: Protein activity loss due to improper storage

    • Solution: Store at -20°C/-80°C as recommended

    • Solution: Ensure consistent temperature during storage (avoid frost-free freezers)

    • Solution: Add glycerol (final concentration 50%) for long-term storage

    • Verification: Test activity of stored protein against fresh preparations periodically

Implementing these preventive measures and verification steps will significantly improve experimental reliability when working with recombinant sheep ST7 protein.

How can researchers validate the specificity and activity of recombinant sheep ST7 in experimental systems?

To validate the specificity and activity of recombinant sheep ST7 in experimental systems:

  • Analytical Validation:

    • Western Blotting: Use both anti-His and anti-ST7 antibodies to confirm identity

    • Mass Spectrometry: Verify protein sequence coverage and post-translational modifications

    • Size Exclusion Chromatography: Confirm monomeric state and absence of aggregation

    • Circular Dichroism: Assess proper secondary structure folding

    • Thermal Shift Assay: Evaluate protein stability and proper folding

  • Functional Validation:

    • Binding Assays: Confirm interaction with known binding partners using SPR or ELISA

    • Dose-Response Curves: Demonstrate concentration-dependent effects in cellular assays

    • Competition Assays: Show displacement by unlabeled ST7 or known ligands

    • Activity Assays: Measure downstream signaling effects (e.g., phosphorylation changes)

    • Negative Controls: Include heat-denatured ST7 or irrelevant proteins with similar tags

  • Specificity Controls:

    • Antibody Blocking: Pre-incubate with validated anti-ST7 antibodies to neutralize activity

    • Domain Mapping: Use recombinant fragments to identify functional domains

    • Point Mutations: Introduce mutations in key residues to ablate specific functions

    • Knockdown/Knockout Validation: Test in cellular systems with reduced or absent endogenous ST7

    • Cross-Species Comparison: Compare activity with ST7 proteins from other species

  • Cellular Response Validation:

    • Cell Type Specificity: Test effects across multiple cell types to confirm expected selectivity

    • Receptor Dependency: Verify dependence on putative receptors using blocking antibodies

    • Pathway Activation: Monitor known downstream effectors (Western blot, reporter assays)

    • Transcriptional Profiling: Compare gene expression changes to established ST7 signatures

    • Phenotypic Assays: Confirm expected cellular responses (proliferation, migration, etc.)

  • Validation Workflow Example:

    Validation StepMethodExpected ResultControl
    PuritySDS-PAGESingle band at ~66 kDaN/A
    IdentityWestern BlotPositive with anti-His and anti-ST7Irrelevant His-tagged protein
    FoldingCircular DichroismSpectrum consistent with predicted secondary structureDenatured protein
    BindingSPRKD consistent with literature valuesBlocking with anti-ST7 antibody
    ActivityPhospho-WesternActivation of known downstream targetsHeat-inactivated protein
    SpecificityCellular assayEffect in ST7-responsive cells, not in ST7-nonresponsive cellsST7 knockdown cells

This comprehensive validation approach ensures that experimental results can be confidently attributed to specific ST7 activity rather than contaminants, degradation products, or non-specific effects .

What strategies can address batch-to-batch variability in recombinant sheep ST7 protein preparations?

To address batch-to-batch variability in recombinant sheep ST7 protein preparations:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.