Recombinant Sheep T-cell surface glycoprotein CD3 delta chain (CD3D)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Domains

CD3D is a single-pass type I transmembrane protein with conserved structural features across species. The sheep CD3D recombinant protein typically includes:

DomainAmino Acid Residues (Sheep)Key Features
ExtracellularVal19–Thr99Contains immunoglobulin-like folds critical for TCR/CD3 complex stability .
TransmembraneNot explicitly mappedHydrophobic region facilitating membrane anchoring; interacts with TCR subunits .
CytoplasmicNot explicitly mappedIncludes immunoreceptor tyrosine-based activation motifs (ITAMs) for signaling .

The recombinant protein is expressed in E. coli with a His-tag or tag-free configuration, yielding a molecular weight of ~10.5–11 kDa under reducing conditions .

Functional Role in Immune Signaling

CD3D is indispensable for T-cell activation and thymocyte differentiation. Key functions include:

  • Signal Transduction: Collaborates with CD3γ, ε, and ζ chains to transmit TCR-recognized signals via ITAM phosphorylation by Src kinases (LCK, FYN) .

  • Complex Assembly: Ensures proper intracellular assembly and surface expression of the TCR/CD3 complex, vital for T-cell development .

  • Pathway Involvement: Participates in critical immune pathways such as:

PathwayRelated Proteins
T-cell receptor signalingCD3G, MAPK3, NFKBIB
Hematopoietic cell lineageCD3G, IL7R, ITGA5
Primary immunodeficiencyCD40LG, ICOS, BLNK

Production and Characterization

Recombinant sheep CD3D is synthesized using prokaryotic systems:

Production Workflow

StepMethodology
Gene CloningCD3D extracellular domain (Val19–Thr99) cloned into pET-28a(+) vector .
ExpressionInduced in E. coli BL21, forming inclusion bodies .
PurificationAffinity chromatography (Ni-NTA for His-tag); >95% purity confirmed by SDS-PAGE .
ValidationWestern blot with rabbit anti-sheep CD3 polyclonal antibodies .

Biochemical Properties:

  • Isoelectric point: 6.0–6.73 .

  • Stability: <5% degradation after 48 hours at 37°C .

  • Endotoxin levels: <1.0 EU/μg .

Key Studies

  • Immune Cell Distribution: CD3+ T-cell density increases significantly in sheep small intestine during Moniezia benedeni infection, highlighting CD3D’s role in mucosal immunity .

Intestinal SegmentCD3+ T-cell Density (cells/10⁴ μm²)
Control
Duodenum (LP)6.01
Jejunum (Epithelium)7.93
Ileum (LP)6.43
  • Antibody Development: Rabbit polyclonal antibodies against recombinant CD3D show high specificity, enabling precise immunohistochemistry and flow cytometry applications .

Applications

  • Diagnostic Tools: Used in ELISA, Western blot (WB), and immunoprecipitation (IP) to study TCR/CD3 complex dynamics .

  • Therapeutic Research: Investigated in autoimmune and infectious disease models to modulate T-cell responses .

Challenges and Future Directions

While recombinant CD3D has advanced ovine immunology research, challenges include optimizing soluble expression in E. coli and refining antibody cross-reactivity for multispecies studies . Future work may explore its role in vaccine adjuvants and checkpoint inhibition therapies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this requirement in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
CD3D; T-cell surface glycoprotein CD3 delta chain; T-cell receptor T3 delta chain; CD antigen CD3d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-167
Protein Length
Full Length of Mature Protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
RALEVLEAEDKVILKCNSSITLLQGTAGQEVSDNKTLNLGKRIEDPRGMYQCGENAKSFTLQVYYRMCQNCVELDSATLAGLIITDIIATVLLALGVYCFAGHETGRFSRAADTQVLMGNDQLYQPLRERNDAQYSRLGDKWARNK
Uniprot No.

Target Background

Function
The CD3 delta chain (CD3D) is a component of the TCR-CD3 complex found on the surface of T-lymphocytes. It plays a pivotal role in adaptive immune responses. When antigen-presenting cells (APCs) activate T-cell receptors (TCRs), TCR-mediated signals are transmitted across the cell membrane through the CD3 chains: CD3D, CD3E, CD3G, and CD3Z. Each CD3 chain contains immunoreceptor tyrosine-based activation motifs (ITAMs) within its cytoplasmic domain. Upon TCR engagement, these motifs undergo phosphorylation by Src family protein tyrosine kinases LCK and FYN, leading to the activation of downstream signaling pathways. Beyond its role in signal transduction during T-cell activation, CD3D is crucial for thymocyte differentiation. It participates in the correct assembly and surface expression of the intracellular TCR-CD3 complex. In the absence of a functional TCR-CD3 complex, thymocytes cannot differentiate properly. CD3D interacts with CD4 and CD8, establishing a functional link between the TCR and coreceptors CD4 and CD8. This link is essential for the activation and positive selection of CD4 or CD8 T-cells.
Database Links

KEGG: oas:443397

UniGene: Oar.427

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
CD3D is mostly present on T-lymphocytes with its TCR-CD3 partners. Present also in fetal NK-cells.

Q&A

What is the structural composition of sheep CD3D and how does it compare to other species?

The CD3 delta chain in sheep is part of the CD3 complex associated with the T-cell antigen receptor (TCR). The CD3 complex consists of five different polypeptide chains (gamma, delta, epsilon, zeta, and eta) with molecular weights ranging from 16-28kDa . Comparative studies through cDNA cloning have revealed that while sheep CD3D shares significant homology with human and mouse counterparts, there are notable structural differences including short oligopeptide deletions in both gamma and delta chains . Despite these variations, the general structure remains markedly conserved across species, particularly two critical motifs consisting of 8 and 32 amino acids located in the C-terminal half that are precisely preserved in all three species . These conserved regions likely contribute essential structural properties for the CD3/TCR complex functionality.

What role does CD3D play in T-cell development and immune function in sheep?

CD3D serves as a critical component in T-cell development and function. The CD3 complex, including the delta chain, is closely associated with the T-cell antigen receptor at the lymphocyte cell surface and is involved in signal transduction following antigen recognition . The expression pattern of CD3D provides significant insights into T-cell development: it is first detectable in early thymocytes, representing one of the earliest markers of commitment to the T-cell lineage . In cortical thymocytes, CD3 is predominantly intracytoplasmic, while in medullary thymocytes, it appears on the T-cell surface . This developmental regulation highlights CD3D's role in T-cell maturation processes. In sheep intestinal tissues, CD3+ T cells are diffusely distributed in the intestinal lamina propria and mucous epitheliums, with distribution densities varying across intestinal segments .

How can researchers accurately detect CD3D expression in sheep tissue samples?

Detection of CD3D in sheep tissues can be accomplished through several validated methodologies:

  • Immunohistochemistry/Immunofluorescence: Using specific antibodies like rabbit anti-sheep CD3 polyclonal antibodies that demonstrate good potency and specificity . The protocol typically involves:

    • Tissue fixation and preparation

    • Antigen retrieval

    • Primary antibody incubation (anti-CD3D)

    • Secondary antibody application (e.g., goat anti-rabbit IgG conjugated to fluorophores)

    • Counterstaining with DAPI for nuclear visualization

    • Observation under fluorescence microscopy

  • Flow Cytometry: For quantitative analysis of CD3D expression on individual sheep T cells.

  • RT-PCR/qPCR: For detection and quantification of CD3D mRNA expression in various tissues or isolated cell populations. Analysis of sheep CD3D mRNA has revealed transcripts of approximately 1.5 kb from single-copy genes .

What experimental considerations are critical when producing recombinant sheep CD3D protein?

Production of functional recombinant sheep CD3D requires careful attention to several factors:

  • Expression System Selection: Mammalian expression systems are often preferred over bacterial systems for proper folding and post-translational modifications. Chinese Hamster Ovary (CHO) or Human Embryonic Kidney (HEK293) cells are commonly used.

  • Protein Tagging Strategy: Strategic placement of purification tags is essential to maintain functional integrity. C-terminal tags are generally preferable to N-terminal tags to avoid interfering with signal peptide processing.

  • Glycosylation Considerations: Sheep CD3D contains potential N-linked glycosylation sites that vary in number and position compared to human and mouse orthologs . Proper glycosylation may be essential for stability and functional studies.

  • Protein Solubility: The transmembrane nature of CD3D presents challenges for solubility and proper folding. Detergent selection or production of only the extracellular domain may be necessary depending on the research application.

  • Conservation of Key Motifs: Special attention should be paid to preserving the highly conserved 8 and 32 amino acid motifs in the C-terminal half of the protein, as these likely contribute essential structural properties for function .

How do mutations in sheep CD3D affect T-cell development and immune function?

Mutations in CD3D can significantly impact T-cell development and immune function, as evidenced by human studies of CD3 delta SCID. In humans, CD3 delta SCID is caused by a mutation in the CD3D gene that prevents production of the CD3 delta protein necessary for normal T-cell development from blood stem cells . While sheep-specific CD3D mutations have been less extensively characterized, the high degree of conservation suggests similar impacts:

  • Disruption of T-cell Development: Mutations likely affect thymocyte maturation, particularly the transition from cortical (where CD3 is predominantly intracytoplasmic) to medullary thymocytes (where CD3 appears on the cell surface) .

  • Impaired TCR Complex Assembly: Mutations may prevent proper association with other CD3 chains and the TCR, affecting surface expression and stability.

  • Compromised Signal Transduction: Many mutations disrupt the conserved motifs in the C-terminal region that are essential for signal transduction following antigen recognition .

  • Immunodeficiency: Severe mutations could result in immunodeficiency comparable to human CD3 delta SCID, where affected individuals are unable to produce functional T cells and therefore cannot mount effective immune responses against pathogens .

What are the implications of CD3D expression patterns in disease models and comparative immunology?

CD3D expression patterns have significant implications across several research domains:

What genome editing techniques are applicable for studying CD3D function in sheep models?

Recent advances in genome editing offer powerful tools for studying CD3D function:

  • Base Editing: This ultraprecise form of genome editing enables correction of single-letter mutations in DNA . A UCLA-led study demonstrated successful use of base editing to correct CD3D mutations in blood stem cells, restoring their ability to produce T cells . For sheep models, this approach could:

    • Create precise mutations in conserved motifs to study structure-function relationships

    • Correct naturally occurring mutations in sheep CD3D

    • Introduce human CD3D mutations into sheep models to study disease mechanisms

  • CRISPR/Cas9: Traditional CRISPR approaches can generate CD3D knockout sheep models to study complete loss of function or introduce specific mutations.

  • Knock-in Approaches: Fluorescent protein tagging of CD3D can enable live-cell imaging studies of CD3D trafficking and TCR complex assembly in sheep T cells.

These technologies offer unprecedented precision for investigating CD3D function in vivo and could lead to therapeutic applications for immunodeficiencies.

What bioinformatic approaches can identify functional domains and evolutionary patterns in sheep CD3D?

Several bioinformatic methods are valuable for analyzing sheep CD3D:

  • Multiple Sequence Alignment: Comparison of CD3D sequences across species reveals conserved regions that likely have critical functional importance. The identification of precisely conserved 8 and 32 amino acid motifs in the C-terminal half of CD3D across sheep, human, and mouse demonstrates the value of this approach .

  • Structural Prediction: Homology modeling based on solved structures of human CD3D can predict the three-dimensional conformation of sheep CD3D and identify potential interaction surfaces.

  • Phylogenetic Analysis: Constructing phylogenetic trees based on CD3D sequences helps understand evolutionary relationships and selective pressures on this protein across species .

  • Protein-Protein Interaction Networks: Analysis of potential interaction partners can reveal functional networks. CD3D has been shown to interact with CD8A in humans , and similar interaction maps in sheep could identify species-specific signaling pathways.

  • Transcriptomic Analysis: RNA-seq data analysis can identify co-expressed genes and regulatory networks associated with CD3D in different sheep tissues and developmental stages.

How should researchers optimize immunohistochemical protocols for detecting CD3D in sheep tissues?

Optimization of immunohistochemical protocols for sheep CD3D detection requires attention to several key factors:

  • Antibody Selection: Use validated antibodies with confirmed specificity for sheep CD3D. Polyclonal rabbit anti-sheep CD3 antibodies have demonstrated good potency and specificity in research applications .

  • Tissue Preparation:

    • Fix tissues appropriately (typically 4% paraformaldehyde)

    • Use optimal section thickness (typically 4-5 μm for paraffin sections)

    • Apply effective antigen retrieval methods to expose epitopes that may be masked during fixation

  • Protocol Optimization:

    • Determine optimal primary antibody dilution through titration experiments

    • Select appropriate secondary detection systems (fluorescent or enzymatic)

    • Include positive controls (sheep thymus or lymph nodes) and negative controls (isotype or secondary-only)

  • Quantification Methods:

    • For distribution analysis, utilize systematic counting in defined tissue areas (e.g., cells/10^4 μm^2)

    • Use digital image analysis for consistent quantification across samples

  • Dual Staining Approaches:

    • Combine CD3D staining with other markers (e.g., CD4, CD8) to identify specific T-cell subsets

    • Use nuclear counterstains like DAPI for contextual tissue architecture

What are the main challenges in distinguishing sheep CD3D from other CD3 chains in experimental systems?

Distinguishing sheep CD3D from other CD3 chains presents several challenges:

  • Structural Similarity: CD3 chains share structural features that can lead to antibody cross-reactivity. The delta and gamma chains in particular show similarity in sheep .

  • Limited Commercial Reagents: Compared to human and mouse, fewer sheep-specific antibodies and reagents are available for distinguishing between CD3 chains.

  • Sequence Variations: The short oligopeptide deletions identified in sheep CD3D compared to human and mouse counterparts may affect epitope recognition by antibodies developed against other species .

  • Co-expression Patterns: CD3 chains are co-expressed in T cells, making isolation of individual chain expression difficult without specific reagents.

Strategies to address these challenges include:

  • Development of monoclonal antibodies targeting unique epitopes in sheep CD3D

  • Use of recombinant expression systems to produce individual CD3 chains for antibody validation

  • Application of molecular techniques (qPCR, RNAscope) that can distinguish between specific CD3 chain transcripts

How can researchers apply findings from CD3D studies to develop therapeutics for immunodeficiencies?

Translational applications of CD3D research include:

  • Gene Therapy Approaches: The successful use of base editing to correct CD3D mutations in human cells suggests similar approaches could be developed for sheep models of immunodeficiency. This could involve:

    • Ex vivo modification of hematopoietic stem cells

    • In vivo delivery of gene editing components using viral vectors

    • Precise correction of pathogenic mutations while maintaining regulatory elements

  • Immunomodulatory Strategies: Understanding CD3D's role in T-cell signaling could inform the development of targeted immunomodulatory therapies that enhance or suppress specific aspects of T-cell function.

  • Diagnostic Applications: Characterization of CD3D expression patterns in different immune disorders could lead to improved diagnostic tools, particularly for conditions affecting T-cell development or function.

  • Cross-Species Applications: The significant conservation of CD3D structure across species suggests that therapeutic approaches developed in one species may have broader applications, facilitating translational research.

What novel approaches could enhance detection and functional analysis of sheep CD3D?

Emerging technologies offer new opportunities for CD3D research:

  • Single-Cell RNA Sequencing: This technology enables comprehensive analysis of CD3D expression at the individual cell level, revealing heterogeneity within T-cell populations and developmental trajectories .

  • CRISPR Screening: Functional genomic screens could identify genes that interact with CD3D or affect its expression and function in sheep T cells.

  • Proteomics Approaches: Mass spectrometry-based techniques can identify post-translational modifications specific to sheep CD3D and characterize protein-protein interaction networks.

  • Organoid Models: Development of thymic organoids could provide ex vivo systems for studying CD3D's role in sheep T-cell development under controlled conditions.

  • Advanced Imaging Technologies: Super-resolution microscopy and intravital imaging could reveal dynamic aspects of CD3D localization and function in live cells and tissues.

How do sheep T-cell populations expressing CD3D respond to various infectious challenges compared to other species?

Comparative analysis of T-cell responses across species reveals both similarities and differences:

  • Parasite Infections: In sheep infected with Moniezia benedeni, CD3+ T-cell density increases significantly in intestinal tissues, with varying degrees across different intestinal segments . This demonstrates a robust local T-cell response to intestinal parasites that may differ from responses in other species.

  • Tissue Distribution Patterns: In sheep, CD3+ T cells are diffusely distributed in the intestinal lamina propria and mucous epitheliums with distinct density patterns from duodenum to ileum . These distribution patterns may reflect species-specific adaptations to common pathogens.

  • Conservation of Signaling Mechanisms: Despite structural variations, the conservation of key signaling motifs in CD3D across species suggests fundamental similarity in signal transduction mechanisms, though the magnitude and kinetics of responses may differ.

  • Species-Specific Disease Susceptibility: Different CD3D structure and expression patterns may contribute to species-specific susceptibility or resistance to certain pathogens, informing comparative immunology studies and potential therapeutic approaches.

What unique features of sheep CD3D might contribute to species-specific immune characteristics?

Several aspects of sheep CD3D may contribute to unique immune characteristics:

  • Structural Variations: The short oligopeptide deletions identified in sheep CD3D relative to human and mouse proteins may affect receptor complex assembly or signal transduction kinetics.

  • Glycosylation Patterns: Differences in the number and position of potential N-linked glycosylation sites compared to other species could influence protein stability, interaction with other TCR components, or recognition by accessory molecules.

  • Expression Regulation: The mRNA of sheep CD3D (1.5 and 1.2 kb transcripts) is transcribed from closely linked, single-copy genes , suggesting potentially unique regulatory mechanisms that may influence T-cell development and activation thresholds.

  • Tissue-Specific Distribution: The distribution patterns of CD3+ T cells in sheep tissues, particularly in mucosal sites like the intestine , may reflect adaptations to environmental challenges specific to sheep.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.