Recombinant Sheep T-cell surface glycoprotein CD3 zeta chain (CD247)

What is the structure and function of CD247 in the T-cell receptor complex?

CD247 (T-cell surface glycoprotein CD3 zeta chain) is a critical component of the T-cell receptor-CD3 complex. The protein consists of 164 amino acids with a predicted molecular weight of approximately 18.7 kiloDaltons . CD247 belongs to the CD3 complex, which comprises five different polypeptide chains: gamma, delta, epsilon, zeta, and eta, with molecular weights ranging from 16-28 kDa .

Functionally, CD247 plays an essential role in coupling antigen recognition to several intracellular signal-transduction pathways . The CD3 complex is closely associated with the T cell antigen receptor (TCR) at the lymphocyte cell surface and is involved in signal transduction to the T cell interior following antigen recognition . Low expression of CD247 results in impaired immune response, highlighting its significance in T cell functionality .

How can researchers express and purify recombinant sheep CD247?

Recombinant sheep CD247 (specifically fragment 22-166 aa) can be expressed in E. coli expression systems with either a His-tag or in tag-free form . The purification typically involves the following methodological approach:

• Vector Construction: Clone the CD247 fragment (amino acids 22-166) into an appropriate bacterial expression vector.

• Expression Conditions: Transform into E. coli and induce protein expression under optimized conditions.

• Purification Steps:

  • For His-tagged protein: Use immobilized metal affinity chromatography (IMAC)

  • For tag-free versions: Employ conventional chromatography techniques

• Quality Control: Validate purity (>90%) using SDS-PAGE

• Functional Validation: Assess biological activity through functional ELISA to confirm binding capability

The amino acid sequence for the sheep CD247 fragment (22-166 aa) is: QSFGLLDPKLCYLLDGILFIYGVIVTALFLRAKFSRSADAPAYQHGQNPVYNELNVGRREEYAVLDRRGGFDPEMGGKPQRKKNPHEVVYNELRKDKMAEAYSEIGMKSDNQRRRGKGHDGVYQGLSTATKDTYDALHMQALPPR

What are the recommended applications for recombinant sheep CD247 in experimental research?

Recombinant sheep CD247 can be utilized in multiple experimental applications:

• Immunochemical Techniques:

  • ELISA (Enzyme-Linked Immunosorbent Assay): For quantitative detection and protein-protein interaction studies

  • Western Blotting (WB): For specific detection and molecular weight confirmation

  • Immunoprecipitation (IP): For studying protein complexes and interactions

• Comparative Studies: Researchers can compare sheep CD247 structure and function with human and other species' counterparts to elucidate evolutionary conservation of T cell signaling mechanisms.

• Pathway Analysis: CD247 participates in several critical immune pathways including:

  • Natural killer cell-mediated cytotoxicity

  • T cell receptor signaling pathway

  • Chagas disease (American trypanosomiasis)

When designing experiments, it's recommended to use freshly prepared solutions of the protein and optimize assay conditions for each specific application.

How does CD247 contribute to chimeric antigen receptor (CAR) functionality in T cell engineering?

CD3ζ (CD247) serves as a critical signaling component in chimeric antigen receptor (CAR) design, with complex mechanisms that extend beyond simple signal transduction:

Methodologically, researchers investigating CAR designs can employ ITAM-mutant and transmembrane-modified receptors to study activation mechanisms. For instance, moving the interchain disulfide bond from the transmembrane C2 to the extracellular G-10 position eliminates heterodimerization with endogenous CD3ζ while maintaining homodimerization and TCR interaction capabilities .

What are the optimal strategies for assessing CD247 functionality in experimental models?

Advanced assessment of CD247 functionality requires multi-parametric approaches:

• Surface Expression Analysis:

  • Flow cytometry using anti-CD3ε antibodies to detect surface TCR/CD3 complex rescue in CD3ζ-deficient cell lines (e.g., MA5.8)

  • Quantitative measurement of CD3 complex components co-expressed with recombinant CD247

• Signaling Pathway Activation:

  • Measurement of immediate signaling events:

    • Phosphorylation of CD3ζ ITAMs

    • ZAP70 recruitment

    • Initiation of MAPK cascade

  • Assessment of downstream events:

    • CD69 up-regulation (flow cytometry)

    • NFAT activation (reporter assays)

• Functional Outcome Measurement:

  • T cell proliferation assays

  • Cytokine production analysis (IFN-γ, IL-2)

  • Cytotoxicity assays against target cells

When comparing wild-type versus mutant CD247 constructs, researchers should examine both proximal signaling events and functional outcomes to comprehensively understand the protein's role in T cell activation.

How can researchers troubleshoot variability in CD247-based experimental systems?

Experimental variability when working with recombinant CD247 can arise from multiple sources:

• Protein Quality Control Issues:

  • Ensure protein purity >90% by SDS-PAGE analysis

  • Confirm proper folding using circular dichroism or functional binding assays

  • Assess lot-to-lot consistency through standardized activity assays

• Expression System Considerations:

  • E. coli-expressed proteins may lack post-translational modifications present in mammalian systems

  • Validate protein functionality using binding assays before complex experiments

  • Consider testing both tagged and untagged versions to rule out tag interference

• Cell Line Variability:

  • When using cell lines like Jurkat or its derivatives (JRT3-T3.5 or MA5.8), confirm their TCR/CD3 expression status

  • Account for intrinsic differences in cellular sensitivity to stimulation between cell lines

  • Establish standardized positive and negative controls for each experimental system

• Experimental Design Solutions:

  • Include multiple time points when measuring activation markers (e.g., CD69)

  • Use titration of stimuli to establish dose-response relationships

  • Normalize data to internal controls when comparing across experiments

What are the key considerations when investigating CD247's role in comparative immunology using sheep models?

Sheep models offer unique perspectives for comparative immunology research involving CD247:

• Evolutionary Conservation Analysis:
  The sheep CD247 sequence (QSFGLLDPKLCYLLDGILFIYGVIVTALFLRAKFSRSADAPAYQHGQNPVYNELNVGRREEYAVLDRRGGFDPEMGGKPQRKKNPHEVVYNELRKDKMAEAYSEIGMKSDNQRRRGKGHDGVYQGLSTATKDTYDALHMQALPPR) can be aligned with human and other species' sequences to identify:

  • Conserved functional domains

  • Species-specific variations that might affect antibody recognition

  • Structural elements critical for TCR complex assembly

• Immunohistochemical Applications:
  When using anti-CD3 antibodies for sheep tissue analysis:

  • The CD3 antibody stains both membrane and cytoplasm

  • CD3 is first detectable in early thymocytes (early T cell lineage commitment marker)

  • In cortical thymocytes, CD3 is predominantly intracytoplasmic

  • In medullary thymocytes, CD3 appears on the T cell surface

• Methodological Adaptations:

  • Optimize antibody concentrations for sheep-specific tissues

  • Adjust antigen retrieval protocols for sheep tissues

  • Validate cross-reactivity of anti-human antibodies with sheep epitopes

• Research Applications:

  • Developmental immunology studies (thymic development)

  • Comparative immune response analysis

  • Veterinary immunopathology investigations

How can CD247 be utilized in T cell neoplasm classification studies?

CD247/CD3 is a valuable marker for T cell classification in pathological contexts:

• Diagnostic Applications:

  • CD3 is a highly specific marker for T cells

  • The antigen is present in the majority of T cell neoplasms

  • CD3 antibodies can be used in immunohistochemistry (IHC) to identify T cells in both benign and malignant disorders

• Methodological Approach:

  • Tissue preparation: Formalin-fixed, paraffin-embedded sections

  • Antigen retrieval: Heat-induced epitope retrieval is typically required

  • Visualization systems: Detection using polymer-based or avidin-biotin-based methods

  • Counterstaining: Hematoxylin for nuclear visualization

• Interpretation Guidelines:

  • Positive CD3 staining in membrane and cytoplasm indicates T cell lineage

  • Pattern of staining (membranous vs. cytoplasmic) may indicate maturation stage

  • Correlation with other T cell markers (CD4, CD8, etc.) for comprehensive classification

What are the implications of CD247 in experimental chimeric antigen receptor T cell therapy research?

CD247's role in CAR-T cell research has significant implications:

• Signaling Domain Architecture:
  Experimental evidence demonstrates that CD3ζ-based CARs can activate T cells through:

  • Direct signaling via the CD3ζ chain itself

  • Indirect mechanisms involving the endogenous TCR complex

• Optimizing CAR Designs:
  Researchers can enhance CAR functionality by:

  • Modifying the transmembrane domain to control TCR complex interactions

  • Adjusting ITAM configurations to fine-tune signaling strength

  • Creating receptors capable of eliciting polyfunctional responses in primary human T cells

• Experimental Methods for CAR Assessment:

  • Flow cytometry to measure activation markers (CD69)

  • Western blotting to detect CAR expression and dimerization patterns

  • Functional assays measuring cytokine production and cytotoxicity

• Future Research Directions:

  • Development of CARs with optimized signaling properties

  • Investigation of CAR-endogenous TCR interactions

  • Creation of species-specific CARs for veterinary applications

What are the optimal storage and handling conditions for recombinant sheep CD247?

To maintain optimal activity of recombinant sheep CD247:

• Storage Recommendations:

  • Store lyophilized protein at -20°C

  • After reconstitution, aliquot and store at -80°C

  • Avoid repeated freeze-thaw cycles

• Reconstitution Guidelines:

  • Use sterile buffer (PBS or manufacturer's recommended buffer)

  • Allow protein to reach room temperature before reconstitution

  • Gently mix by inversion rather than vortexing to prevent denaturation

• Working Solution Preparation:

  • Prepare fresh working solutions on the day of experiment

  • Filter through 0.22μm filter if necessary

  • Keep on ice during experimental procedures

• Quality Control Measures:

  • Verify protein activity periodically using functional ELISA

  • Check for signs of precipitation or degradation

  • Use positive controls in experiments to confirm activity

How can researchers optimize CD247-based signal transduction analysis in experimental systems?

For detailed analysis of CD247-mediated signal transduction:

• Experimental System Selection:
  Different cell lines offer distinct advantages:

  • Jurkat T cells: Standard T cell line for activation studies

  • JRT3-T3.5 cells: TCR-β-deficient, useful for studying CAR signaling without TCR interference

  • MA5.8 cells: CD3ζ-deficient, ideal for studying CD247 complementation

• Activation Assessment Methods:

  • Flow cytometry for surface markers (CD69)

  • Phospho-flow for intracellular signaling events

  • Western blotting for protein phosphorylation

  • ELISA for cytokine production

• Receptor Engineering Approaches:

  • ITAM-mutant receptors (Y-F substitutions) to dissect signaling requirements

  • Transmembrane domain modifications to alter receptor interactions

  • Controlling dimerization through disulfide bridge positioning

• Data Analysis Recommendations:

  • Use dose-response curves rather than single-point measurements

  • Normalize data to appropriate controls

  • Consider kinetic analyses to capture temporal signaling dynamics

  • Integrate multiple readouts for comprehensive pathway analysis