Recombinant Sheep Thyrotropin receptor (TSHR)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TSHR; Thyrotropin receptor; Thyroid-stimulating hormone receptor; TSH-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-764
Protein Length
Full Length of Mature Protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
ERCPSPPCECRQEDDFRVTCKDIQRIPSLPPSTQTLKFIETHLKTIPSRAFSNLPNISRI YLSIDATLQQLESHSFYNLSKVTHIEIRNTRSLTYIDSGALKELPLLKFLGIFNTGLRVF PDLTKIYSTDVFFILEITDNPYMTSVPANAFQGLSNETLTLKLYNNGFTSIQGHAFNGTK LDAVYLNKNKYLTVIDQDAFAGVYSGPTLLDISYTSVTALPSKGLEHLKELIARNTWTLK KLPLSLSFLHLTRADLSYPSHCCAFKNQKNIRGILQSLMCNESSIWGLRQRKSASALNGP FYQEYEEDLGDGSAGYKENSKFQDTHSNSHYYVFFEDQEDEIIGFGQELKNPQEETLQAF DNHYDYTVCGGSEEMVCTPKSDEFNPCEDIMGYKFLRIVVWFVSLLALLGNVFVLVILLT SHYKLTVPRFLMCNLAFADFCMGLYLLLIASVDLYTQSEYYNHAIDWQTGPGCNTAGFFT VFASELSVYTLTVITLERWYAITFAMHLDRKIRLWHAYVIMLGGWVCCFLLALLPLVGIS SYAKVSICLPMDTETPLALAYIILVLLLNIIAFIIVCACYVKIYITVRNPHYNPGDKDTR IAKRMAVLIFTDFMCMAPISFYALSALMNKPLITVTNSKILLVLFYPLNSCANPFLYAIF TKAFQRDVFMLLSKFGICKRQAQAYRGQRVSSKNSTGIRVQKVPPDVRQSLPNVQDDYEL LGNSHLTPKQQDQTSKEYKQTVL
Uniprot No.

Target Background

Function

The recombinant sheep thyrotropin receptor (TSHR) is a receptor for thyroid-stimulating hormone (TSH) and thyrostimulin (a heterodimeric glycoprotein hormone, GPHA2:GPHB5). Its activation, mediated by G proteins, stimulates adenylate cyclase. TSHR plays a critical role in regulating thyroid cell metabolism.

Database Links

KEGG: oas:443428

UniGene: Oar.558

Protein Families
G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of sheep Thyrotropin receptor (TSHR)?

Sheep Thyrotropin receptor (TSHR) is a member of the heterotrimeric G protein-coupled family of receptors that plays a critical role in regulating thyroid cell proliferation and thyroid hormone synthesis and release. The receptor consists of a large extracellular domain responsible for ligand binding, seven transmembrane domains that anchor the receptor to the cell membrane, and an intracellular domain that couples to G proteins to initiate downstream signaling cascades.

The primary function of TSHR is to bind thyroid-stimulating hormone (TSH), which activates adenylate cyclase through Gs proteins, leading to increased intracellular cAMP levels. This triggers protein kinase A (PKA) signaling cascades that ultimately regulate thyroid hormone production. Studies using knockout models have demonstrated that TSHR expression is required for sodium-iodide symporter (NIS) expression but not for thyroglobulin expression, indicating that the thyroid hormone synthetic pathway can be dissociated into TSHR-dependent and -independent steps .

How should researchers design expression systems for recombinant sheep TSHR production?

When designing expression systems for recombinant sheep TSHR, researchers should consider the following methodological approaches:

  • Vector selection: Use mammalian expression vectors containing strong promoters such as CMV for high-level expression. Include appropriate selection markers (e.g., antibiotic resistance genes) for stable integration.

  • Host cell selection: HEK293 or CHO cells are preferred for mammalian expression due to their ability to perform proper post-translational modifications. For smaller fragments or epitopes, bacterial systems like E. coli can be used with appropriate optimization.

  • Codon optimization: Adjust the coding sequence for optimal codon usage in the selected expression system to enhance translation efficiency.

  • Signal peptide incorporation: Include a signal peptide sequence to direct the recombinant protein to the secretory pathway or cell membrane.

  • Purification tags: Incorporate affinity tags (His-tag, FLAG-tag) strategically to facilitate purification while minimizing interference with receptor function. For optimal results, consider using the Ni-NTA His-Tag purification methodology as demonstrated in similar receptor studies .

Researchers should verify expression using techniques such as Western blotting, flow cytometry, or immunofluorescence to confirm proper localization and conformation of the recombinant receptor.

What are the key protocols for functional validation of recombinant sheep TSHR?

Functional validation of recombinant sheep TSHR requires multiple complementary approaches:

  • Ligand binding assays: Use radiolabeled or fluorescently labeled TSH to determine binding affinity (Kd) and capacity (Bmax) through saturation binding experiments. Competitive binding assays with known TSHR ligands can verify specificity.

  • cAMP accumulation assays: As TSHR primarily signals through Gs proteins, measure cAMP production using ELISA or reporter gene assays following TSH stimulation. Dose-response curves should be generated to determine EC50 values.

  • Calcium mobilization assays: Use fluorescent calcium indicators to assess TSHR coupling to Gq proteins and subsequent calcium signaling.

  • Receptor internalization studies: Employ fluorescently tagged antibodies or receptors to track TSHR internalization following ligand binding using confocal microscopy.

  • Conformational integrity assessment: Use conformation-sensitive antibodies in flow cytometry or ELISA to verify that the recombinant receptor maintains native structure.

Evidence from TSHR knockout studies indicates that forskolin can rescue some TSHR-dependent functions in thyroid cells, suggesting this compound can be used as a positive control in functional validation experiments by bypassing receptor activation and directly stimulating adenylate cyclase .

How can researchers identify and characterize B-cell epitopes in sheep TSHR?

Identification and characterization of B-cell epitopes in sheep TSHR require systematic approaches:

  • Overlapping peptide design strategy: Design overlapping peptides covering the entire TSHR sequence. For optimal results, each peptide should span 15 amino acids with a step size of 5 amino acids and an overlap of 10 amino acids, as demonstrated in similar epitope mapping studies .

  • ELISA-based epitope mapping: Coat ELISA plates with individual peptides or peptide mixtures and screen using sera from immunized animals. This allows identification of immunoreactive regions. For higher sensitivity, use horseradish peroxidase (HRP)-conjugated secondary antibodies specific to different immunoglobulin classes (IgG, IgM, IgA, IgE) and subclasses (IgG1, IgG2) .

  • Epitope optimization: Once initial epitopes are identified, design new peptides with variations in length and amino acid composition to define optimal epitope boundaries and enhance immunoreactivity.

  • Tandem epitope construction: Connect identified epitopes in tandem to potentially enhance immunogenicity, as this approach has shown significant improvement in efficacy for other antigens .

  • Conformational epitope analysis: Complement linear epitope mapping with techniques such as hydrogen-deuterium exchange mass spectrometry or X-ray crystallography to identify conformational epitopes.

  • Cross-reactivity assessment: Test identified epitopes against antibodies from different species to determine conservation and specificity.

Statistical analysis should be performed using appropriate software such as GraphPad Prism, with comparisons between groups executed using unpaired t-tests or one-way ANOVA for multiple groups .

What strategies are effective for studying sheep TSHR knockout models?

Based on established TSHR knockout methodologies, researchers should consider the following approaches:

  • Gene targeting strategy: Design homologous recombination vectors that replace critical exons of the TSHR gene with a reporter gene such as GFP. This allows visualization of cells that would normally express TSHR while disrupting receptor function .

  • Genotyping protocols: Develop reliable PCR-based genotyping assays to distinguish between wild-type, heterozygous, and homozygous knockout animals. Nested RT-PCR targeting deleted regions can confirm the absence of functional transcripts .

  • Phenotypic characterization: Assess growth, development, and thyroid function parameters including serum T3, T4, and TSH levels. TSHR-KO animals typically show profound hypothyroidism with no detectable thyroid hormone and significantly elevated TSH (up to 400-fold higher than wild type) .

  • Radioactive iodide uptake assays: Measure the ability of thyroid tissue to concentrate iodide using radioactive tracers. TSHR-KO models show dramatically reduced uptake (approximately 40-fold lower than wild-type) .

  • Rescue experiments: Test the ability of forskolin or other adenylate cyclase activators to restore TSHR-dependent functions in knockout models, which can help distinguish between direct and indirect effects of TSHR signaling .

  • Molecular profiling: Examine expression of thyroid-specific genes such as NIS and thyroglobulin using RT-PCR, Western blotting, and immunohistochemistry to understand downstream effects of TSHR deletion .

  • Hormone replacement protocols: Develop appropriate thyroid hormone supplementation regimens to maintain knockout animals, such as extended weaning periods or thyroid powder-supplemented diets (T100 or T250 diets) .

How can recombinant sheep TSHR be used to develop epitope-based vaccines?

Development of epitope-based vaccines using recombinant sheep TSHR involves several key methodological steps:

  • Epitope identification: Use bioinformatics tools combined with experimental methods (ELISA, peptide arrays) to identify both B-cell and T-cell epitopes within the TSHR sequence. Focus on regions that elicit strong immune responses and are conserved across target populations.

  • Epitope optimization: Modify identified epitopes to enhance stability, immunogenicity, and specificity while maintaining recognition by the target immune system. This may involve amino acid substitutions, cyclization, or other structural modifications .

  • Epitope combination: Connect multiple epitopes in tandem to create multi-epitope constructs, which has been demonstrated to significantly enhance efficacy compared to single epitopes .

  • Adjuvant selection: Test different adjuvants for their ability to enhance the immune response to TSHR epitopes. For sheep, Quil A has shown effectiveness in enhancing both humoral and cellular immune responses .

  • Immunization schedule optimization: Determine optimal primary and booster immunization schedules. For sheep, a 4-week interval between initial and booster vaccinations has proven effective for epitope-based vaccines .

  • Immune response evaluation: Comprehensively assess the immune response by measuring various antibody isotypes (IgG, IgM, IgA, IgE) and subclasses (IgG1, IgG2) at different time points post-immunization using ELISA methods .

  • Protection assessment: Evaluate the protective efficacy of the vaccine through appropriate challenge models or functional assays specific to TSHR-mediated processes.

The table below summarizes a typical immunization protocol for epitope-based vaccine evaluation in sheep:

GroupImmunogenAdjuvantPrimary DoseBooster DoseIntervalCollection Points
ControlPBSNone1 mL1 mL4 weeks0, 2, 4, 6, 8, 10, 12 weeks
Adjuvant controlNoneQuil A1 mg1 mg4 weeks0, 2, 4, 6, 8, 10, 12 weeks
EpitopeTSHR epitope(s)None50 μg50 μg4 weeks0, 2, 4, 6, 8, 10, 12 weeks
Epitope + AdjuvantTSHR epitope(s)Quil A50 μg + 1 mg50 μg + 1 mg4 weeks0, 2, 4, 6, 8, 10, 12 weeks

What are the current challenges in purifying full-length recombinant sheep TSHR?

Purification of full-length recombinant sheep TSHR presents several methodological challenges:

  • Membrane protein solubilization: As a seven-transmembrane receptor, TSHR requires careful solubilization from membranes. Researchers should screen detergents (DDM, CHAPS, digitonin) at various concentrations to identify optimal conditions that maintain receptor structure and function.

  • Glycosylation heterogeneity: TSHR is heavily glycosylated, resulting in heterogeneous preparations. Enzymatic deglycosylation may improve homogeneity but risks affecting conformational epitopes. Alternatively, expression in glycosylation-deficient cell lines can reduce heterogeneity.

  • Proteolytic cleavage: TSHR undergoes natural proteolytic processing into α and β subunits, complicating purification of intact receptor. Use of protease inhibitor cocktails during all purification steps is essential.

  • Low expression levels: GPCR expression levels are typically low. Consider using inducible expression systems and optimization of culture conditions (temperature, inducer concentration) to maximize yield.

  • Purification tag interference: Tags may interfere with TSHR structure or function. Strategic placement of tags and inclusion of cleavable linkers can minimize interference. The Ni-NTA His-Tag purification system has been effectively used for similar complex proteins .

  • Conformational stability: Maintaining native conformation during purification is critical. Include stabilizing agents (glycerol, cholesterol) in buffers and consider the use of conformation-specific antibodies or nanobodies for affinity purification.

  • Endotoxin removal: For immunological studies, endotoxin contamination must be eliminated. Implement dedicated endotoxin removal steps using commercially available kits as part of the purification workflow .

How do post-translational modifications affect sheep TSHR function?

Post-translational modifications (PTMs) critically influence sheep TSHR function in several ways:

  • N-linked glycosylation: The extracellular domain of TSHR contains multiple N-glycosylation sites that affect receptor folding, trafficking to the cell surface, and ligand binding affinity. Systematic mutation of these sites and analysis of receptor function can identify critical glycosylation positions.

  • Palmitoylation: Cysteine residues in the C-terminal tail may undergo palmitoylation, affecting receptor association with lipid rafts and signaling efficiency. Mass spectrometry following metabolic labeling with palmitate analogs can identify palmitoylated residues.

  • Phosphorylation: Multiple serine and threonine residues in intracellular loops and the C-terminus can be phosphorylated by various kinases, regulating desensitization and internalization. Phospho-specific antibodies and phosphoproteomics can map these modifications.

  • Proteolytic processing: TSHR undergoes complex proteolytic cleavage into α and β subunits that remain linked by disulfide bonds. This processing affects receptor structure and potentially its signaling properties. Site-directed mutagenesis of putative cleavage sites can elucidate the functional significance.

  • Sulfation: Tyrosine residues in the extracellular domain may undergo sulfation, potentially influencing ligand recognition. Radiolabeling with [35S]sulfate followed by immunoprecipitation can identify sulfated residues.

To study these modifications experimentally:

  • Use enzymatic deglycosylation (PNGase F, Endo H) to assess glycosylation's impact on receptor function

  • Create expression constructs with mutations at predicted modification sites

  • Employ pulse-chase experiments to track receptor maturation and processing

  • Use mass spectrometry approaches (LC-MS/MS) for comprehensive PTM mapping

  • Develop site-specific antibodies that recognize modified forms of the receptor

What are the optimal methods for measuring sheep TSHR-mediated signaling?

Measuring sheep TSHR-mediated signaling requires carefully designed experimental approaches:

  • cAMP assays: As the primary signaling pathway for TSHR is through Gs proteins, measuring cAMP production is essential. Use either:

    • Real-time measurement with FRET-based sensors (EPAC-based reporters)

    • Endpoint assays using competitive ELISA

    • Reporter gene assays using CRE-luciferase constructs

  • Calcium signaling: For assessment of Gq-mediated signaling:

    • Real-time calcium imaging with fluorescent indicators (Fluo-4, Fura-2)

    • FLIPR-based plate reader assays for high-throughput screening

    • Calcium-dependent reporter gene assays

  • ERK/MAPK pathway activation:

    • Western blotting with phospho-specific antibodies

    • In-cell Western assays for higher throughput

    • FRET-based biosensors for real-time measurements

  • β-arrestin recruitment:

    • Bioluminescence resonance energy transfer (BRET) assays

    • Enzyme complementation assays

    • Confocal microscopy with fluorescently tagged proteins

  • Receptor internalization:

    • Flow cytometry with antibodies against extracellular epitopes

    • ELISA-based quantification of surface receptors

    • Live-cell imaging with pH-sensitive fluorescent tags

When comparing signaling responses, include appropriate controls:

  • Forskolin as a direct adenylate cyclase activator (positive control for cAMP pathways)

  • Known TSHR agonists and antagonists at defined concentrations

  • Vehicle controls for all treatments

How should researchers design comparative studies between sheep and human TSHR?

When designing comparative studies between sheep and human TSHR, researchers should incorporate these methodological considerations:

  • Sequence and structural analysis:

    • Perform comprehensive sequence alignments to identify conserved and divergent regions

    • Use homology modeling to predict structural differences in key domains

    • Focus on the extracellular domain, which shows the highest variability between species

  • Expression system standardization:

    • Express both receptors in the same cell background to minimize system-related variables

    • Use identical promoters, tags, and vector backbones

    • Quantify surface expression levels to normalize functional readouts

  • Pharmacological profiling:

    • Generate complete dose-response curves for standard agonists

    • Calculate and compare key parameters (EC50, Emax, Hill coefficient)

    • Test species-selective compounds to identify binding pocket differences

  • Signaling pathway comparison:

    • Measure activation of multiple pathways (Gs, Gq, G12/13, β-arrestin)

    • Assess signaling kinetics using real-time measurement techniques

    • Quantify signaling bias between pathways for various ligands

  • Molecular dynamics simulations:

    • Model ligand-receptor interactions in silico

    • Identify species-specific interaction hotspots

    • Validate predictions through site-directed mutagenesis

  • Antibody cross-reactivity assessment:

    • Test antibodies against different receptor epitopes for specificity

    • Develop species-specific and cross-reactive antibody panels

    • Map binding regions through epitope analysis

This systematic approach allows for detailed characterization of species differences that may impact drug development, disease modeling, and basic understanding of TSHR biology.

How should researchers resolve contradictory findings in sheep TSHR studies?

When confronted with contradictory findings in sheep TSHR research, implement this systematic approach:

  • Methodological comparison:

    • Create a detailed table comparing experimental methods across studies

    • Identify variations in expression systems, cell lines, and assay conditions

    • Evaluate differences in protein tags, purification methods, and storage conditions

  • Biological source analysis:

    • Compare sheep breeds/strains used in different studies

    • Assess age, sex, and physiological status of animals

    • Consider potential genetic polymorphisms in the TSHR gene

  • Replication experiments:

    • Design experiments that directly compare methodologies side-by-side

    • Implement standardized protocols across laboratories

    • Use statistical power analysis to ensure adequate sample sizes

  • Meta-analysis approaches:

    • Apply formal meta-analysis techniques when multiple studies exist

    • Use random-effects models to account for between-study heterogeneity

    • Generate forest plots to visualize effect sizes across studies

  • Orthogonal validation:

    • Confirm findings using multiple independent techniques

    • Validate in vitro results with in vivo or ex vivo approaches

    • Employ different detection methods for the same biological phenomenon

  • Technical considerations:

    • Evaluate antibody specificity through proper controls

    • Assess the impact of post-translational modifications on measurements

    • Consider the sensitivity and dynamic range of detection methods

Published knockout model studies demonstrate the importance of comprehensive validation, as they revealed unexpected findings regarding TSHR-dependent and -independent thyroid hormone synthesis pathways that resolved previous contradictions in the literature .

What statistical approaches are most appropriate for analyzing sheep TSHR immunological data?

Analysis of sheep TSHR immunological data requires appropriate statistical methods:

  • Basic comparative statistics:

    • Use unpaired t-tests for comparing two experimental groups

    • Apply one-way ANOVA with appropriate post-hoc tests (Tukey, Dunnett) for multiple group comparisons

    • Consider non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) when normality assumptions are violated

  • Longitudinal data analysis:

    • Implement repeated measures ANOVA for time-course studies

    • Use mixed-effects models to account for subject-specific variability

    • Apply area-under-the-curve (AUC) analysis for antibody response over time

  • Correlation analysis:

    • Calculate Pearson or Spearman correlation coefficients between antibody levels and functional outcomes

    • Perform regression analysis to identify predictive relationships

    • Use multivariate approaches to identify patterns across multiple parameters

  • Epitope mapping analysis:

    • Apply sliding window analysis for overlapping peptide data

    • Use cluster analysis to identify immunologically similar regions

    • Implement predictive algorithms to correlate epitope features with immunogenicity

  • Presentation of results:

    • Present data as mean ± standard deviation for normally distributed data

    • Consider median and interquartile range for skewed distributions

    • Use appropriate graphical representations (box plots, violin plots) for distribution visualization

  • Sample size and power considerations:

    • Conduct a priori power analysis to determine required sample sizes

    • Report effect sizes alongside p-values

    • Consider multiple testing correction for high-dimensional data

Software packages such as GraphPad Prism 8.0 and SPSS version 22.0 are particularly suitable for these analyses, providing both statistical testing and high-quality visualization options .

What emerging technologies will advance sheep TSHR research?

Several emerging technologies promise to significantly advance sheep TSHR research:

  • CRISPR-Cas9 genome editing:

    • Generation of precise knock-in and knockout sheep models

    • Introduction of reporter tags at endogenous loci

    • Creation of humanized TSHR sheep for translational research

  • Single-cell technologies:

    • Single-cell RNA-seq to identify TSHR-expressing cell populations

    • Single-cell proteomics to characterize receptor expression heterogeneity

    • Spatial transcriptomics to map TSHR expression in tissue context

  • Cryo-electron microscopy:

    • Structural determination of sheep TSHR alone and in complex with ligands

    • Visualization of conformational changes upon activation

    • Comparison with human TSHR structures to guide drug design

  • Nanobody and synthetic antibody technologies:

    • Development of highly specific sheep TSHR-targeting reagents

    • Creation of conformation-selective probes for active vs. inactive states

    • Engineering of antibody-based modulators for functional studies

  • Optogenetic and chemogenetic approaches:

    • Light-controlled or small molecule-controlled TSHR activation

    • Spatiotemporal control of signaling in specific tissues

    • Investigation of tissue-specific consequences of TSHR activation

  • Organ-on-chip and organoid technologies:

    • Development of sheep thyroid organoids for ex vivo studies

    • Integration of multiple tissues to study systemic effects

    • High-throughput screening of TSHR modulators in physiologically relevant systems

  • Computational approaches:

    • Advanced molecular dynamics simulations of sheep TSHR

    • AI-driven prediction of species-specific ligand interactions

    • Systems biology modeling of TSHR signaling networks

Integration of these technologies will enable unprecedented insights into sheep TSHR biology, with implications for both veterinary medicine and comparative endocrinology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.