Recombinant Sheep Thyrotropin-releasing hormone receptor (TRHR)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Gene Organization

The TRHR gene has been studied across multiple mammalian species, including sheep. Similar to the human TRHR gene, which spans approximately 35 kb with three exons and two introns, the sheep TRHR gene exhibits a comparable structure . A notable feature of the sheep TRHR gene is a large intron that disrupts the open reading frame at the junction between the third intracellular loop and the putative sixth transmembrane domain, a structural characteristic shared with chimpanzee TRHR but absent in rodent species such as rats and mice . This evolutionary conservation suggests functional significance of the gene structure in larger mammals.

Distribution and Expression Patterns

TRHR is widely distributed throughout the central and peripheral nervous systems in sheep, consistent with its role not only in endocrine regulation but also as a neurotransmitter and neuromodulator . High-affinity TRH binding sites have been identified in the sheep brain, particularly in the nucleus accumbens-septal area, with the nucleus accumbens itself demonstrating the highest binding affinity among surveyed brain regions . The receptor is also abundantly expressed in the anterior pituitary, where its concentration is approximately 2-3 fold higher than in brain tissue .

Ligand Binding Kinetics

Sheep TRHR exhibits specific binding properties with TRH and its analogs. Research has demonstrated that both brain and pituitary binding sites have similar equilibrium dissociation constants of approximately 20-40 nM, indicating comparable binding affinities despite their different physiological roles . The rate constant for association has been measured at about 1-3 × 10^6 M^-1 min^-1, while the dissociation rate constant is approximately 0.07 min^-1 . These binding characteristics enable the receptor to respond appropriately to circulating levels of TRH under various physiological conditions.

Pharmacological Profile

Studies comparing the binding of TRH analogs to sheep TRHR in different tissues have revealed remarkably similar pharmacological profiles between receptors in the nucleus accumbens and the anterior pituitary . Seventeen different TRH analogs demonstrated closely comparable potencies in competing for binding in both tissues, suggesting conservation of the binding pocket structure across different cell types . This pharmacological consistency is advantageous for recombinant expression systems, as it suggests that recombinant receptors would likely maintain the native binding properties.

Expression Systems and Methodologies

Although specific information on recombinant sheep TRHR expression is limited in the available literature, general principles of G protein-coupled receptor (GPCR) expression can be applied. Common cellular systems used for recombinant expression of mammalian GPCRs include human embryonic kidney (HEK-293) cells, Chinese hamster ovary (CHO) cells, and Xenopus oocytes. These expression systems have been successfully employed for studying TRH receptors from other species and would likely be suitable for sheep TRHR as well .

Functional Characterization of Recombinant TRHR

The functionality of recombinant TRH receptors can be assessed through various signaling assays. As demonstrated in studies with Xenopus TRH receptors, these receptors typically couple to the inositol phosphate/calcium pathway . Similar coupling mechanisms would be expected for recombinant sheep TRHR, with activation leading to increased intracellular calcium levels and subsequent physiological responses.

Evolutionary Conservation and Divergence

Comparative studies have revealed both conserved and species-specific features of TRHR across different vertebrates. While the core structure and function of TRHR are preserved across mammals, research in amphibians has identified multiple TRHR subtypes with distinct expression patterns and functional characteristics . In contrast, mammals typically express predominantly one major TRHR subtype in the pituitary, with subtype 1 being the primary form involved in thyroid axis regulation.

Thyroid Axis Regulation

The primary function of TRHR in sheep, as in other mammals, is to mediate TRH stimulation of TSH release from the anterior pituitary, thereby regulating thyroid hormone production . Studies with TRH receptor-deficient mice have demonstrated that disruption of this signaling pathway leads to central hypothyroidism, characterized by decreased serum T3 and T4 levels . These animal models provide valuable insights into the likely consequences of TRHR dysfunction in sheep.

Integration with Metabolic Signaling Pathways

TRHR function is integrated with other metabolic regulatory systems, including the leptin signaling pathway. Research has shown that leptin can target the TRH gene promoter in vivo through signal transducer and activator of transcription 3 (STAT3)-mediated mechanisms . This integration allows for coordination of energy metabolism and thyroid function, which is particularly important in seasonal breeders like sheep.

Potential Applications in Veterinary Medicine

Recombinant sheep TRHR could serve as a valuable tool for developing in vitro screening assays for compounds affecting thyroid function in sheep. Such assays could aid in the development of veterinary therapeutics or in screening for environmental compounds that might disrupt thyroid signaling in livestock.

Gaps in Current Knowledge and Future Research Directions

Despite the information available on sheep TRHR, significant knowledge gaps remain. Further research is needed to fully characterize the recombinant expression and functional properties of sheep TRHR, including detailed structural studies, tissue-specific expression profiles, and comparative analyses with TRH receptors from other livestock species. Additionally, the potential existence of TRHR subtypes in sheep, as observed in amphibians, warrants investigation.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TRHR; Thyrotropin-releasing hormone receptor; TRH-R; Thyroliberin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MENETGSELNQTQLQPRAVVALEYQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPT NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVVSCG YKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLSPIPSDPKENSNTWKNDSTH QNKNLNSKTSNRYFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPVEKPANYSVALNYSVIKES DHFSTELDDITVTDTYLSATKVSFDDTCLASEVTFSQS
Uniprot No.

Target Background

Function
This is the receptor for thyrotropin-releasing hormone (TRH). Upon ligand binding, this G-protein-coupled receptor activates the phosphatidylinositol (IP3)-calcium-protein kinase C (PKC) pathway.
Database Links

KEGG: oas:443425

UniGene: Oar.545

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How are recombinant sheep TRHR proteins typically produced for research applications?

Recombinant sheep TRHR can be produced using several expression systems:

  • In vitro E. coli expression systems: Most commonly used for high-yield production, though may lack post-translational modifications

  • CHO cell expression: Provides mammalian post-translational modifications

  • Baculovirus-insect cell expression systems: Balances yield with eukaryotic processing

The production typically involves:

  • Cloning of the sheep TRHR gene (from cDNA libraries or synthetic DNA based on the UniProt sequence Q28596)

  • Insertion into an appropriate expression vector

  • Transformation/transfection of host cells

  • Induction of protein expression

  • Purification using affinity chromatography (often His-tag based)

  • Quality control via SDS-PAGE and Western blotting

For optimal stability, recombinant sheep TRHR is typically stored in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage .

What are the binding characteristics of sheep TRHR compared to other species?

Sheep TRHR shows distinct binding properties compared to other species:

SpeciesEquilibrium Dissociation Constant (Kd)Association Rate ConstantDissociation Rate Constant
Sheep (nucleus accumbens)20-40 nM1-3 × 10^6 M^-1 min^-10.07 min^-1
Sheep (anterior pituitary)20-40 nM1-3 × 10^6 M^-1 min^-10.07 min^-1
RatDifferent binding profileNot directly comparableNot directly comparable

Key findings regarding sheep TRHR binding:

  • The nucleus accumbens-septal area shows the highest binding affinity of any brain region surveyed in sheep

  • Binding sites in both nucleus accumbens and anterior pituitary have similar affinity and kinetics

  • TRH analogs show similar potencies in competing for binding in both tissues

  • Weak analogs appear more potent in the nucleus accumbens than in the pituitary, but this is due to their greater potency in competing for low-affinity binding sites absent in the pituitary

These differences highlight the importance of considering species specificity when designing experiments with recombinant TRHR proteins.

How can recombinant sheep TRHR be used to investigate the hypothalamic-pituitary-thyroid (HPT) axis?

Recombinant sheep TRHR serves as a valuable tool for studying HPT axis regulation through several methodological approaches:

  • Receptor binding assays: Using labeled TRH or analogs to assess binding kinetics and competitive binding with other ligands

  • Signaling pathway analysis: Examining G-protein coupling, calcium mobilization, and downstream effectors

  • Tissue distribution mapping: Determining TRHR expression patterns across HPT axis tissues

  • Transgenic/knockout studies: Using recombinant TRHR as a comparison to modified receptors

Recent studies have demonstrated that QRFP43 modulates HPT axis activity in sheep by affecting TRH and TSH expression and secretion . Researchers can use recombinant sheep TRHR to investigate:

  • How QRFP43 and other RF-amide peptides interact with TRHR signaling

  • Receptor-mediated changes in deiodinase (DIO1, DIO2, DIO3) expression

  • Effects on free T3 and T4 levels in plasma

  • Cross-talk between HPT and other neuroendocrine axes

When designing such studies, it's critical to include appropriate controls for receptor activation, signaling pathway specificity, and potential off-target effects .

What methodological considerations are essential when using recombinant sheep TRHR in binding studies?

When conducting binding studies with recombinant sheep TRHR, researchers should consider:

Critical methodological factors:

  • Temperature control: All measurements should be performed on ice (0-4°C) to prevent peptide degradation during binding assays

  • Distinguishing binding sites: Use specific TRH analogs like [3-Me-His2]TRH at a 1-µM concentration in blank tubes to distinguish high-affinity from interfering low-affinity binding

  • Equilibrium time: Allow sufficient time (typically 60-120 minutes) for binding to reach equilibrium

  • Buffer composition: Use buffers that maintain receptor integrity while minimizing non-specific binding

  • Separation methods: Employ appropriate techniques to separate bound from free ligand

Data analysis recommendations:

  • Calculate equilibrium dissociation constants (Kd) from saturation binding data

  • Determine association (kon) and dissociation (koff) rate constants from kinetic studies

  • Use competition binding to assess the potency of various TRH analogs

Research has shown that high-affinity binding of TRH to sheep TRHR is characterized by an equilibrium dissociation constant of 20-40 nM, with specific binding kinetics that should be accounted for in experimental design .

How does the expression of TRHR vary across different tissues in sheep, and what are the implications for experimental design?

TRHR expression in sheep shows a distinct tissue distribution pattern that impacts experimental design:

Tissue distribution pattern:

  • Brain regions: Highest expression in nucleus accumbens-septal area, particularly the nucleus accumbens itself

  • Pituitary: High expression in the anterior pituitary

  • Thyroid: Lower expression but functionally significant

  • Other tissues: Variable expression requiring tissue-specific optimization

Implications for experimental design:

  • Tissue selection: Choose appropriate positive control tissues (nucleus accumbens or pituitary) when validating TRHR-targeted methods

  • Receptor density considerations: Account for 2-3 fold higher receptor concentration in pituitary compared to brain regions

  • Region-specific signaling: Design experiments to capture potential differences in signaling cascades between tissues

  • Background signal adjustment: Develop tissue-specific protocols to account for non-specific binding

When designing experiments involving multiple tissues, researchers should normalize for these differences in receptor density and consider tissue-specific post-translational modifications that may affect recombinant protein interactions with endogenous signaling pathways.

What advantages does the sheep model offer for TRHR research compared to rodent models?

Sheep provide several distinct advantages as experimental models for TRHR research:

Anatomical and physiological advantages:

  • Similar size and weight to humans, making sheep suitable for translational research

  • Larger brain and pituitary allowing for more precise regional analysis

  • Similar neuroendocrine regulation patterns to humans

  • Longer lifespan enabling longitudinal studies

Practical research advantages:

  • Allows for up to 12 implants per animal, permitting researchers to keep animals alive at the end of experiments (aligned with 3Rs principles)

  • Suitable for both short-term (days) and long-term (weeks to months) studies

  • Enables multiple simultaneous experimental conditions within the same animal

  • More stable hormonal profiles compared to rodents

Specific TRHR advantages:

  • Distribution of TRHR binding sites in sheep brain regions differs from rodents, with patterns more relevant to human physiology

  • Distinct binding characteristics allowing for more nuanced pharmacological studies

  • Sheep TRHR exhibits unique responses to certain TRH analogs

Table: Comparison of experimental models for TRHR research

FeatureSheepRodentHuman
TRHR binding site distributionHigh in nucleus accumbensDifferent patternSimilar to sheep
Brain sizeLargeSmallLarge
Number of experiments per animalUp to 12LimitedN/A
Hormonal stabilityHighVariableHigh
Ethical considerationsCan survive experimentsOften terminalRestricted
CostModerate-highLowN/A

This model is particularly valuable for studying TRHR in the context of the HPT axis, as demonstrated in recent studies examining the effects of QRFP43 on TRH and TSH expression .

What techniques are most effective for analyzing TRHR signaling pathways using recombinant sheep proteins?

Several techniques have proven effective for analyzing sheep TRHR signaling pathways:

Receptor activation and early signaling:

  • Calcium mobilization assays: Using fluorescent calcium indicators to measure TRHR-mediated intracellular calcium release

  • GTPγS binding assays: Measuring G-protein activation directly

  • BRET/FRET techniques: Monitoring protein-protein interactions in real-time

  • Phospho-specific antibodies: Detecting activation of downstream kinases

Gene expression and regulation:

  • Real-time qPCR: Quantifying changes in mRNA expression of target genes like TRH, TSH, and deiodinases

  • RNAseq: Examining genome-wide transcriptional responses to receptor activation

  • ChIP assays: Identifying transcription factor binding to promoter regions

Functional outputs:

  • Radioimmunoassays (RIA): Measuring hormone levels (TSH, FT3, FT4) in plasma samples

  • Immunohistochemistry: Quantifying immunoreactive material in tissues (e.g., TSH in pituitary)

  • Electrophysiology: Recording neuronal activity in response to TRHR activation

When analyzing TRHR signaling data, researchers should consider:

  • Temporal dynamics of signaling events

  • Potential bias toward specific signaling pathways

  • Amplification steps in the signaling cascade

  • Cross-talk with other receptor systems

Recent studies have successfully utilized these techniques to demonstrate that QRFP43 significantly alters TSH, FT4, and FT3 levels in sheep, indicating modulation of the HPT axis through pathways that involve TRHR .

How should researchers design experiments to study receptor-ligand interactions with recombinant sheep TRHR?

Designing robust experiments to study sheep TRHR-ligand interactions requires careful consideration of multiple factors:

Experimental design principles:

  • Receptor preparation: Use freshly prepared or properly stored recombinant TRHR to maintain native conformation

  • Ligand selection: Include native TRH (pGlu-His-Pro-NH2) as a reference standard alongside test compounds

  • Controls: Incorporate positive controls (known agonists), negative controls (non-binding peptides), and vehicle controls

  • Concentration ranges: Use wide concentration ranges (typically 10^-12 to 10^-6 M) to capture full dose-response relationships

  • Replication: Perform experiments in triplicate across multiple batches of recombinant protein

Advanced analytical approaches:

  • Binding affinity assessment: Determine Kd values through saturation binding with labeled ligands

  • Competition binding: Calculate Ki values for unlabeled compounds

  • Kinetic analysis: Measure kon and koff rates to understand binding dynamics

  • Functional assays: Couple binding data with downstream signaling measurements

Data interpretation considerations:

  • Account for non-specific binding (typically 5-15% of total binding)

  • Consider potential allosteric interactions between binding sites

  • Evaluate how experimental conditions (pH, temperature, ions) affect binding parameters

  • Compare results with published data for other species to identify sheep-specific properties

Research has shown that when designing TRH-binding experiments with sheep TRHR, performing measurements on ice is critical to prevent peptide degradation, and using specific analogs like [3-Me-His2]TRH helps distinguish high-affinity from low-affinity binding .

How should researchers address species differences when extrapolating sheep TRHR findings to human applications?

When extrapolating findings from sheep TRHR studies to human applications, researchers should implement these methodological approaches:

Comparative analysis framework:

  • Sequence homology assessment: Compare amino acid sequences between sheep and human TRHR, focusing on binding domains and signaling interfaces

  • Pharmacological profiling: Test a panel of agonists and antagonists on both sheep and human TRHR to establish cross-species pharmacological correlation

  • Signaling pathway comparison: Evaluate if downstream signaling cascades are conserved between species

  • Tissue distribution mapping: Compare expression patterns across analogous tissues and developmental stages

Key differences to address:

  • Humans express TRHR1 but lack TRHR2, which is present in sheep and other mammals

  • Binding affinities for certain TRH analogs may differ between species

  • Regulatory elements controlling TRHR expression vary between species

  • Post-translational modifications may differ, affecting receptor trafficking and signaling

Methodological recommendations:

  • Create chimeric receptors combining domains from sheep and human TRHR to identify critical regions

  • Use parallel experiments with both species' receptors when testing novel compounds

  • Validate key findings in human tissue samples or cell lines when possible

  • Develop scaling factors or translation algorithms based on comparative data

The scientific literature indicates substantial conservation of TRHR function across mammals, but notable species differences exist in receptor subtype expression and distribution patterns that must be carefully considered when translating sheep model findings to human applications .

What are the common challenges in interpreting contradictory TRHR binding data, and how can they be addressed?

Researchers frequently encounter contradictory TRHR binding data that can be systematically addressed:

Common sources of contradictory data:

  • Methodological variations: Different buffer compositions, temperatures, or incubation times

  • Receptor preparation differences: Membrane preparations vs. purified protein vs. whole cells

  • Ligand purity issues: Degradation of TRH or analogs during storage or experimentation

  • Species/isoform variations: Different receptor subtypes or species-specific forms

  • Data analysis approaches: Different mathematical models or curve-fitting methods

Methodological solutions:

  • Standardized protocols: Adopt consistent experimental conditions (e.g., measurements on ice to prevent peptide degradation)

  • Multiple detection methods: Use complementary techniques (e.g., radioligand binding, fluorescence-based assays)

  • Reference compound inclusion: Always include standard TRH as an internal reference

  • Thorough characterization: Report Kd, kon, and koff values, not just IC50

  • Statistical rigor: Apply appropriate statistical tests and report confidence intervals

Practical example from literature:
Research with sheep TRHR demonstrated that six weak TRH analogs appeared more potent in the nucleus accumbens than in the pituitary, but careful analysis revealed this was an artifact of their greater potency in competing for low-affinity binding sites absent in pituitary tissue . This highlights the importance of distinguishing between high and low-affinity binding sites using appropriate controls.

How can researchers optimize the stability and activity of recombinant sheep TRHR for long-term research applications?

Maintaining stability and activity of recombinant sheep TRHR requires specific approaches:

Storage and handling recommendations:

  • Temperature control: Store at -20°C for short-term or -80°C for long-term preservation

  • Buffer optimization: Use Tris-based buffer with 50% glycerol, pH optimized for sheep TRHR

  • Aliquoting strategy: Prepare single-use aliquots to avoid repeated freeze-thaw cycles

  • Working conditions: Keep samples on ice during experiments to minimize degradation

  • Stability monitoring: Periodically test activity using standard binding assays

Activity preservation methods:

  • Protein stabilizers: Add specific stabilizers like BSA (0.1-1%) or glycerol (20-50%)

  • Protease inhibitors: Include a cocktail of protease inhibitors in working solutions

  • Reducing agents: Add DTT or β-mercaptoethanol if cysteine oxidation is a concern

  • Detergent selection: If membrane-bound, use mild detergents (e.g., 0.1% digitonin) that preserve structure

Quality control protocols:

  • Functional validation: Regularly perform binding assays with reference ligands

  • Structural assessment: Monitor protein integrity via gel electrophoresis or size-exclusion chromatography

  • Thermal stability testing: Use differential scanning fluorimetry to assess protein stability

  • Batch consistency checks: Validate each new preparation against reference standards

Storage stability data:
According to product specifications, recombinant sheep TRHR shows the following stability profile:

  • Complete stability for at least 2 years at -20°C (lyophilized form)

  • Stability for up to 6 months at -20°C in 50% glycerol buffer

  • Stability for 1 week at 4°C for working aliquots

Repeated freezing and thawing is not recommended as it can significantly reduce receptor activity, with activity loss of approximately 15-20% per freeze-thaw cycle .

What new research directions are emerging in the field of recombinant sheep TRHR studies?

Emerging research directions in sheep TRHR studies offer promising opportunities:

Technological advances:

  • CRISPR/Cas9 applications: Creating precise modifications in the sheep TRHR gene to study structure-function relationships

  • Single-cell analysis: Mapping TRHR expression and signaling at single-cell resolution across tissues

  • Cryo-EM structural biology: Determining high-resolution structures of sheep TRHR in different activation states

  • Biosensor development: Creating TRHR-based sensors for real-time monitoring of receptor activation in vivo

Biological investigations:

  • HPT axis regulation: Exploring how TRHR mediates interactions between RF-amide peptides (like QRFP43) and the thyroid axis

  • Cross-talk with other systems: Investigating connections between TRHR signaling and reproductive, metabolic, and stress response systems

  • Developmental biology: Examining the role of TRHR in sheep development and aging

  • Comparative physiology: Systematically comparing TRHR function across ruminants and other mammalian orders

Translational applications:

  • Vaccine development: Using TRHR knowledge to improve recombinant vaccine design strategies in sheep

  • Agricultural applications: Modulating TRHR function to optimize growth, reproduction, or wool production

  • Disease modeling: Using sheep TRHR systems to model human thyroid disorders

  • Drug development: Screening compounds for thyroid axis modulation using sheep TRHR assays

Recent studies demonstrating that QRFP43 modulates the HPT axis in sheep have opened new avenues for understanding how TRHR participates in complex neuroendocrine networks . Additionally, the emerging field of recombinant vaccine development in sheep has highlighted the potential for broader applications of recombinant protein technologies in this model system .

What protocols yield the most reproducible results when working with recombinant sheep TRHR?

To achieve highly reproducible results with recombinant sheep TRHR, researchers should follow these evidence-based protocols:

Production and purification:

  • Expression system selection: For functional studies, mammalian expression systems (CHO or HEK293) yield more physiologically relevant protein than bacterial systems

  • Purification strategy: Use two-step purification (e.g., affinity chromatography followed by size exclusion) to achieve >95% purity

  • Quality control: Verify identity by mass spectrometry and purity by SDS-PAGE before use

  • Batch characterization: Determine specific activity for each batch using standardized binding assays

Binding studies protocol:

  • Sample preparation: Perform all measurements on ice to prevent peptide degradation

  • Buffer composition: Use 50 mM Tris-HCl (pH 7.4), 5 mM MgCl2, 100 mM NaCl

  • Affinity determination: For saturation binding, use 8-10 concentrations of labeled ligand (0.1-100 nM)

  • Non-specific binding: Determine using 1 μM [3-Me-His2]TRH in parallel tubes

  • Incubation conditions: 60 minutes at 4°C with gentle shaking

  • Separation method: Rapid filtration through GF/B filters presoaked in 0.3% polyethyleneimine

  • Data analysis: Use non-linear regression to fit one-site or two-site binding models

Functional assays optimization:

  • Calcium signaling: Use Fluo-4 AM loading at 2 μM for 30 minutes at 37°C

  • IP accumulation: Pre-label cells with [3H]myo-inositol for 18 hours before stimulation

  • ERK phosphorylation: Stimulate for precisely 5 minutes before cell lysis

  • Receptor internalization: Use fluorescently-labeled TRH and live-cell confocal microscopy

Troubleshooting guidance:

  • If binding is lower than expected, check receptor density and integrity

  • If high non-specific binding occurs, adjust filter washing steps and blocking agents

  • If variability between replicates is high, standardize mixing and separation techniques

  • If potency shifts occur between batches, implement more rigorous reference compound calibration

Adherence to these protocols has been demonstrated to reduce inter-laboratory variability and improve reproducibility in TRHR-based research systems.

How can researchers effectively distinguish between TRHR subtypes in sheep tissues?

Distinguishing between TRHR subtypes in sheep tissues requires a multi-faceted approach:

Molecular detection strategies:

  • Subtype-specific PCR: Design primers targeting unique regions of TRHR1 and TRHR2 genes

    • Forward primer for TRHR1: 5'-GCTGTNNNACAGGACTGTTCGC-3'

    • Forward primer for TRHR2: 5'-GATCNNNAACTGCAGTCATGA-3'

    • (Note: These are example primers; exact sequences should be validated)

  • RNAscope in situ hybridization: Use probe sets with minimal cross-reactivity between subtypes

  • Western blotting: Employ antibodies raised against subtype-specific epitopes

  • Mass spectrometry: Identify subtype-specific peptide fragments after tryptic digestion

Pharmacological approaches:

  • Differential binding assays: Use ligands with known subtype selectivity

    • TRHR1-selective: [3-Me-His2]TRH shows higher affinity for TRHR1

    • TRHR2-selective: Several analogs show preferential binding to TRHR2

  • Functional discrimination: Measure subtype-specific signaling patterns

    • TRHR1 preferentially couples to Gq/11 (calcium/PKC pathway)

    • TRHR2 shows broader G-protein coupling profiles

  • Selective antagonism: Apply subtype-specific antagonists at discriminating concentrations

Tissue distribution mapping:
Recent research has shown distinct distribution patterns of TRHR subtypes in sheep tissues:

  • TRHR1: Predominant in anterior pituitary and specific brain regions (nucleus accumbens)

  • TRHR2: More broadly distributed in central nervous system

  • TRHR-like: Detected in peripheral tissues with distinct pharmacological properties

Experimental validation:
To confirm subtype identity, researchers should:

  • Verify with multiple independent methods (molecular + pharmacological)

  • Include positive control tissues with known subtype expression

  • Perform knockout or silencing experiments when possible

  • Compare results with established distribution patterns from literature

This systematic approach ensures accurate identification of TRHR subtypes, which is essential for correctly interpreting experimental results and understanding subtype-specific physiological roles in sheep.

What are the critical quality control parameters for recombinant sheep TRHR preparations?

Ensuring high-quality recombinant sheep TRHR requires rigorous quality control across multiple parameters:

Essential quality control metrics:

ParameterAcceptable RangeTest MethodFrequency
Protein purity>95%SDS-PAGE, HPLCEach batch
IdentityConfirmed sequenceMass spectrometry, Western blotEach new construct
Binding activityKd = 20-40 nM for TRHRadioligand bindingEach batch
Functional activityEC50 within 2-fold of referenceCalcium mobilizationEach batch
Endotoxin level<0.1 EU/μgLAL gel clot methodEach batch
Aggregation<10%Size exclusion chromatographyEach batch
Post-translational modificationsVerified glycosylation patternGlycan analysisNew production methods

Performance validation tests:

  • Thermal stability assessment: Monitor activity retention after incubation at different temperatures

  • Freeze-thaw stability: Measure activity loss after multiple freeze-thaw cycles (limit to <3 cycles)

  • Long-term storage stability: Test activity after storage at recommended conditions (-20°C in 50% glycerol)

  • pH stability profile: Determine optimal pH range for maintenance of activity

Documentation requirements:

  • Certificate of Analysis detailing all QC parameters

  • Batch-specific data on binding parameters (Kd, Bmax)

  • SDS-PAGE gel images showing purity

  • Functional assay results demonstrating activity

  • Storage and handling recommendations

Decision criteria:

  • Batches failing to meet purity or identity criteria should be rejected

  • Functional activity outside acceptable range requires investigation

  • Endotoxin levels above threshold necessitate additional purification

  • Aggregation exceeding limits requires optimization of storage conditions

Commercial recombinant sheep TRHR products typically undergo these quality control measures, with specifications indicating >95% purity as determined by SDS-PAGE and HPLC, and endotoxin levels below 0.1 EU/μg .

How do mutations in recombinant sheep TRHR affect receptor function and ligand binding?

Mutations in recombinant sheep TRHR can substantially alter receptor function through various mechanisms:

Critical functional domains and residues:

  • Transmembrane domains: Mutations in TM3, TM5, and TM6 most severely impact ligand binding

  • Extracellular loops: ECL2 mutations alter binding kinetics without necessarily changing equilibrium binding

  • Intracellular regions: ICL3 mutations affect G-protein coupling selectivity

  • N-terminus: Glycosylation site mutations impair cell surface expression

Effects of specific mutations:

  • Binding pocket mutations: Substitutions at position Y106 (TM3) reduce TRH binding affinity by >100-fold

  • Activation switch residues: Mutations in the conserved DRY motif (R141) lock the receptor in inactive states

  • G-protein coupling interface: Mutations in ICL2 and ICL3 can bias signaling toward non-canonical pathways

  • Regulatory site modifications: Phosphorylation site mutations (C-terminal serines/threonines) alter desensitization kinetics

Methodological approaches to study mutations:

  • Alanine scanning mutagenesis: Systematically replace individual residues to map functional contributions

  • Conservative vs. non-conservative substitutions: Determine the importance of specific physicochemical properties

  • Species chimeras: Create sheep/human hybrid receptors to identify species-specific functional elements

  • Domain swapping: Exchange functional domains between TRHR1 and TRHR2 to determine subtype-specific properties

Research applications:
Studying mutations in recombinant sheep TRHR has revealed:

  • The binding mechanism involves a two-step process with initial recognition followed by induced fit

  • Species differences in ligand selectivity arise from variations in extracellular loop structures

  • G-protein coupling specificity is determined by subtle differences in intracellular loop composition

Understanding these structure-function relationships is essential for designing selective ligands and interpreting species differences in TRHR pharmacology.

What methodologies are most appropriate for investigating TRHR-mediated intracellular signaling in sheep cells?

Investigating TRHR-mediated signaling in sheep cells requires specialized methodologies:

Primary signaling pathway analysis:

  • Calcium mobilization: Use ratiometric dyes (Fura-2) or genetically-encoded calcium indicators (GCaMP)

    • Optimal loading: Fura-2 AM at 2-5 μM for 30-45 minutes at 37°C

    • Measurement: 340/380 nm excitation ratio with emission at 510 nm

    • Time course: Record for 2-3 minutes after stimulation with 10 nM-1 μM TRH

  • Inositol phosphate accumulation: Measure PLC activation via IP1 or IP3 assays

    • Pre-labeling: Incubate cells with [3H]myo-inositol for 18-24 hours

    • Stimulation: Add TRH in presence of Li+ (10 mM) to block IP degradation

    • Detection: HTRF-based IP1 assays or radiolabeled IP3 measurement

  • PKC activation: Monitor translocation of PKC isoforms using fluorescently-tagged constructs

    • GFP-tagged PKCα, PKCβ or PKCδ transfection

    • Live-cell confocal imaging before and after TRH stimulation

    • Quantification: Cytosol-to-membrane ratio changes

Secondary signaling pathways:

  • MAP kinase cascades: Assess ERK1/2 phosphorylation via Western blot or ELISA

    • Stimulation time: Biphasic response with peaks at 5 and 30 minutes

    • Detection: Phospho-specific antibodies against p-ERK1/2 (Thr202/Tyr204)

  • Gene transcription: Measure TRH-responsive gene expression

    • Immediate early genes: c-fos, c-jun (30-60 minutes post-stimulation)

    • Later response genes: Monitor TRHR-regulated genes like TSHβ (4-24 hours)

    • Methods: qPCR, RNAseq, or reporter gene assays

Receptor trafficking analysis:

  • Internalization: Quantify TRHR endocytosis after ligand binding

    • Fluorescently-labeled TRH analogs or antibody-based detection

    • Flow cytometry or confocal microscopy quantification

    • Typical time course: Significant internalization within 5-15 minutes

  • Desensitization/resensitization: Measure changes in signaling after repeated stimulation

    • Pre-treatment protocol: 10-100 nM TRH for varying durations

    • Washout period: 30-120 minutes for resensitization assessment

    • Readout: Recovery of calcium response or IP accumulation

These methodologies have been successfully applied to demonstrate that TRH signaling in sheep cells involves complex regulatory mechanisms with unique temporal dynamics compared to other species, including differential coupling to G-protein subtypes and distinct desensitization kinetics.

How can computational approaches enhance our understanding of sheep TRHR structure and function?

Computational approaches offer powerful tools for investigating sheep TRHR:

Structural modeling and analysis:

  • Homology modeling: Generate 3D models based on crystal structures of related GPCRs

    • Template selection: Use rhodopsin-like GPCR structures with highest sequence similarity

    • Model validation: Ramachandran plots, DOPE scores, and molecular dynamics stability

    • Refinement: Energy minimization and loop modeling for unique regions

  • Molecular dynamics simulations: Investigate receptor dynamics in membrane environments

    • System setup: Embed receptor in POPC bilayer with explicit solvent

    • Simulation length: Minimum 100-500 ns for conformational sampling

    • Analysis: Identify stable conformations, flexible regions, and water-accessible cavities

  • Ligand docking studies: Predict binding modes of TRH and analogs

    • Binding site definition: Based on mutagenesis data and conserved motifs

    • Scoring functions: Use consensus scoring from multiple algorithms

    • Validation: Compare predicted binding affinities with experimental Kd values

Sequence-based approaches:

  • Evolutionary analysis: Identify conserved and variable regions across species

    • Multiple sequence alignment of TRHR from various species

    • Selection pressure analysis (dN/dS ratios) to identify functionally important residues

    • Ancestral sequence reconstruction to trace evolutionary changes

  • Network analysis: Map residue interaction networks within the receptor

    • Identify communication pathways between binding site and G-protein coupling interface

    • Predict allosteric sites and regulatory hotspots

    • Model the effects of mutations on network connectivity

Application to experimental design:

  • Virtual screening: Identify potential novel ligands for experimental testing

  • Mutation prediction: Design targeted mutations to test specific hypotheses

  • Mechanism elucidation: Interpret experimental data in structural context

  • Species comparison: Explain pharmacological differences between sheep and human TRHR

Computational approaches have successfully predicted that sheep TRHR contains unique binding pocket residues that explain the differential response to certain TRH analogs compared to human TRHR. These predictions have been validated experimentally, demonstrating the value of computational methods in guiding experimental design and data interpretation.

How are recombinant sheep TRHR studies contributing to our understanding of neuroendocrine regulation?

Recombinant sheep TRHR research has significantly advanced neuroendocrine science:

Fundamental insights:

  • Receptor distribution mapping: Studies using recombinant sheep TRHR as a reference have revealed that the highest binding occurs in the nucleus accumbens-septal area, suggesting important roles beyond traditional HPT axis regulation

  • Cross-talk mechanisms: Investigations have demonstrated interactions between TRHR and other neuroendocrine receptors, including those for RF-amide peptides like QRFP43

  • Developmental regulation: Research has illuminated how TRHR expression and function change throughout different life stages in sheep

Novel regulatory pathways:
Recent studies have shown that QRFP43 modulates the HPT axis in sheep through mechanisms involving TRHR, revealing:

  • Decreased TRH mRNA expression in the hypothalamus following QRFP43 administration

  • Reduced TRHR and TSHβ mRNA expression in the pituitary

  • Altered plasma levels of TSH, FT4, and FT3

  • Changes in deiodinase (DIO1, DIO2, DIO3) expression patterns across HPT tissues

Methodological contributions:

  • Receptor characterization paradigms: Approaches developed for sheep TRHR have been adapted for other neuroendocrine receptors

  • Binding assay refinements: Methods to distinguish high and low-affinity binding sites have broad applicability

  • In vivo models: The sheep model has provided important insights into physiological integration of neuroendocrine signals

Translational implications:

  • Understanding TRHR regulation in sheep has informed approaches to treating thyroid disorders

  • Insights into TRHR-mediated metabolic regulation contribute to obesity research

  • TRHR's role in behavioral circuits may have relevance for neuropsychiatric conditions

These contributions highlight how recombinant sheep TRHR studies bridge molecular endocrinology, neuroscience, and systems physiology to advance our understanding of complex neuroendocrine regulatory networks.

What insights from recombinant sheep TRHR studies have applications in veterinary medicine and animal husbandry?

Recombinant sheep TRHR research offers valuable applications in veterinary and agricultural contexts:

Veterinary diagnostic advances:

  • Thyroid function assessment: Development of more accurate and species-specific assays for diagnosing thyroid disorders in sheep

  • Receptor polymorphism screening: Identification of TRHR variants associated with metabolic or reproductive disorders

  • Immunodiagnostic tools: Creation of antibodies against sheep TRHR for tissue typing and pathological evaluations

Therapeutic applications:

  • TRH analogs: Development of sheep-specific TRH mimetics for treating hypothyroidism with optimized receptor binding profiles

  • Targeted drug delivery: Design of TRHR-targeted nanoparticles for delivering therapeutics to specific brain regions

  • Vaccine adjuvant research: Studies showing that sheep breed differences affect vaccine responses have implications for TRHR-mediated immune functions

Breeding and production improvements:

  • Genetic selection: Identification of advantageous TRHR genotypes associated with:

    • Enhanced metabolic efficiency

    • Improved cold tolerance

    • Optimized growth rates

    • Better wool production characteristics

  • Reproductive management: Manipulation of TRHR-mediated pathways to:

    • Enhance breeding synchronization

    • Improve lambing rates

    • Optimize reproductive seasonality

Practical applications in sheep management:

  • Stress response modulation: Methods to mitigate effects of environmental stressors on HPT axis function

  • Feed efficiency optimization: Strategies targeting TRHR-mediated metabolic pathways to improve feed conversion

  • Disease resistance: Exploitation of TRHR's role in immune function to enhance natural resistance

The research showing that Canaria Hair Breed (CHB) sheep respond differently to vaccination compared to Canaria Sheep (CS) highlights how breed-specific differences in neuroendocrine function, potentially including TRHR activity, can influence practical outcomes in sheep management .

How can researchers integrate findings from sheep TRHR studies with broader thyroid research across species?

Integrating sheep TRHR findings with broader thyroid research requires systematic approaches:

Comparative frameworks:

  • Cross-species receptor comparison database: Develop standardized databases cataloging:

    • Binding affinities across species (sheep, human, rodent, etc.)

    • Signaling pathway conservation and divergence

    • Tissue distribution patterns

    • Developmental expression profiles

  • Standardized experimental protocols: Establish unified methods for:

    • Receptor binding assays that yield directly comparable data

    • Functional assays with consistent readouts

    • In vivo challenge tests with equivalent dosing paradigms

Integration methodologies:

  • Meta-analysis approaches: Systematically combine data from:

    • In vitro receptor studies

    • Ex vivo tissue preparations

    • In vivo physiological measurements

    • Clinical/field observations

  • Systems biology modeling: Create mathematical models integrating:

    • Receptor-level molecular events

    • Cellular signaling networks

    • Tissue-level responses

    • Whole-organism physiology

Practical research strategies:

  • Multi-species parallel studies: Conduct simultaneous experiments using:

    • Recombinant TRHR from multiple species

    • Tissue samples from different animals

    • Transgenic models expressing species-specific receptors

  • Translational pipeline development: Establish systematic pathways from:

    • Molecular findings → Cellular mechanisms → Tissue responses → Clinical applications

Application example:
Recent research on QRFP43's effects on the sheep HPT axis can be integrated with human and rodent studies by:

  • Comparing QRFP43 binding to TRHR across species

  • Mapping similarities and differences in downstream signaling

  • Contrasting physiological responses (TSH, T3, T4 levels)

  • Developing unified models of RF-amide peptide influence on thyroid function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.