Recombinant Sheep Type-1 angiotensin II receptor (AGTR1)

Shipped with Ice Packs
In Stock

Description

Table 1: AGTR1 Ortholog Comparison

SpeciesGene IDProtein LengthKey Function
Sheep443107359 aaBlood pressure regulation
Human185359 aaHypertension pathogenesis
Domestic Rabbit100009164359 aaReceptor desensitization

Recombinant Production and Purification

Recombinant sheep AGTR1 is typically produced in E. coli or mammalian systems. Key parameters include:

Table 2: Recombinant AGTR1 Production Parameters (Inferred from Rabbit Homolog )

ParameterDetail
Expression SystemE. coli (common for GPCR fragments)
TagN-terminal His-tag for affinity chromatography
Purity>90% (SDS-PAGE validated)
StorageLyophilized in Tris/PBS buffer (pH 8.0) with 6% trehalose
Reconstitution0.1–1.0 mg/mL in sterile water; 50% glycerol for long-term storage

Cardiovascular Regulation

  • AGTR1 in sheep renal nuclei stimulates reactive oxygen species (ROS) via PKC and PI3K pathways, exacerbating oxidative stress in hypertension .

  • Age-dependent AT₁ receptor upregulation correlates with heightened ROS in older sheep, suggesting therapeutic targeting potential .

Signal Transduction

  • Ang II binding induces conformational changes, activating Gαq/11 and downstream effectors (e.g., IP₃, Ca²⁺) .

  • ATRAP interaction modulates AGTR1 internalization and signaling duration, identified via yeast two-hybrid assays .

Applications in Research

  • Drug Development: AGTR1 blockers (e.g., losartan) are modeled using recombinant receptors to assess binding kinetics .

  • Hypertension Studies: Sheep AGTR1 elucidates species-specific angiotensin responses, aiding translational research .

  • Antibody Validation: Anti-AGTR1 antibodies (e.g., #AAR-011) target extracellular epitopes for flow cytometry and Western blot .

Challenges and Future Directions

  • Expression Difficulties: Full-length GPCRs often require chaperones for proper folding in prokaryotic systems .

  • Species-Specific Variations: Sheep AGTR1’s N-terminal epitopes differ subtly from humans, necessitating tailored tools .

  • Therapeutic Targeting: Nanobodies (e.g., ATT118i4 h32) show promise in blocking AGTR1 with reduced polyreactivity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
AGTR1; Type-1 angiotensin II receptor; Angiotensin II type-1 receptor; AT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MILNSSTEDGIKRIQDDCPKAGRHNYIFIMIPTLYSIIFVVGLFGNSLVVIVIYFYMKLK TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASGSVSFNLYASVFLLT CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVC AFHYESQNSTLPVGLGLTKNILGFLFPFLIILTSYTLIWKTLKKAYEIQKNKPRKDDIFK IILAIVLFFFFSWVPHQIFTFMDVLIQLGLIRDCKIEDIVDTAMPITICLAYFNNCLNPP FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSENGNSSTKKPAPCTEVE
Uniprot No.

Target Background

Function
Angiotensin II receptor type 1 (AGTR1) is a receptor for angiotensin II. It mediates angiotensin II's actions by associating with G proteins, which activate a phosphatidylinositol-calcium second messenger system.
Database Links

UniGene: Oar.625

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is AGTR1 and what biological functions does it mediate?

AGTR1 is the angiotensin II type 1 receptor, a key component of the renin-angiotensin system located on chromosome 3. This receptor mediates most of the physiological and pathophysiological effects of angiotensin II, including regulation of blood pressure, fluid and electrolyte balance, and cell growth and differentiation. At the molecular level, AGTR1 activation triggers several signal transduction pathways, notably PI3K/Akt and Ras/MAPK, which are essential for its biological functions. Its importance in cardiovascular health is underscored by the association between AGTR1 variations and conditions like hypertension, myocardial infarction, and heart failure .

How does sheep AGTR1 differ from human AGTR1 in terms of structure and function?

While both sheep and human AGTR1 maintain the core functionality of angiotensin II binding, they exhibit species-specific variations in amino acid sequences, particularly in the C-terminal region. For example, research on rat AGTR1 shows that its C-terminal portion (amino acids 341-355; PSD-NMSSSAKKPASC) differs from the mouse sequence by one amino acid (PSD-NMSSAAKKPASC) . Similar variations exist between sheep and human AGTR1, potentially affecting receptor coupling to G proteins and interaction with regulatory proteins such as ATRAP, which binds to the carboxyl-terminal cytoplasmic domain of AT1 receptors .

These structural differences can influence receptor pharmacology, including binding affinity for angiotensin II and response to receptor antagonists. Nevertheless, the core signaling mechanisms remain conserved across species, making sheep AGTR1 a valuable model for comparative studies.

What is the current understanding of AGTR1 subtypes and their distribution in different tissues?

In mammals, AGTR1 exists in different subtypes, with mice expressing two variants: AT1a and AT1b. The distribution of these receptors varies significantly across tissues. In the brain, for instance, AT1aR-EGFP cells show a distribution that closely corresponds to angiotensin II binding sites and AT1aR protein and mRNA locations .

The AGTR1 receptor is broadly expressed throughout the body, with particularly high concentrations in cardiovascular tissues, kidneys, adrenal glands, and specific brain regions. This distribution reflects its diverse physiological roles in different organ systems. In research models such as the Agtr1a BAC transgenic reporter mouse line, AT1aR-EGFP is detectable in cell nuclei and cytoplasm, predominantly in neurons, and often extends into dendritic processes .

What are the optimal expression systems for producing recombinant sheep AGTR1?

The optimal expression system for recombinant sheep AGTR1 depends on the research objectives. For structural studies requiring large quantities of functional protein, mammalian expression systems such as HEK293 or CHO cells are preferred as they provide appropriate post-translational modifications and membrane integration.

For antibody production and protein interaction studies, bacterial or yeast systems expressing portions of the receptor (particularly the C-terminal domain) may be sufficient. Based on related research methodologies, effective strategies include:

  • Bacterial artificial chromosome (BAC) transgenic systems, similar to those used for Agtr1a-EGFP mouse models

  • Recombinant DNA technology in mammalian cells for full-length receptor expression

  • Transgenic animal models for in vivo studies of receptor function

The choice between these systems should be guided by considerations of protein yield, functional integrity, and experimental requirements.

What purification strategies are most effective for sheep AGTR1?

Purification of membrane proteins like AGTR1 presents significant challenges due to their hydrophobic nature. Based on established protocols for G protein-coupled receptors (GPCRs), the following stepwise approach is recommended:

  • Solubilization using mild detergents (e.g., n-dodecyl-β-D-maltoside or digitonin) to extract the receptor from membranes while preserving its native conformation

  • Affinity chromatography using tagged recombinant constructs (His-tag, FLAG-tag) or ligand-based columns

  • Size exclusion chromatography to achieve high purity

  • Validation of purified receptor through binding assays and functional tests

For research applications requiring only specific domains of AGTR1, such as the C-terminal cytoplasmic region that interacts with proteins like ATRAP, bacterial expression systems can yield sufficient material for studies .

What validation methods should be used to confirm the identity and functionality of recombinant sheep AGTR1?

Multiple complementary approaches should be employed to validate recombinant sheep AGTR1:

Molecular Validation:

  • Western blot analysis using specific antibodies (like those listed in result )

  • Mass spectrometry to confirm protein identity and post-translational modifications

Functional Validation:

  • Radioligand binding assays with angiotensin II to confirm ligand-binding capacity

  • Signal transduction assays measuring calcium mobilization or MAP kinase activation

  • Co-immunoprecipitation studies to verify interactions with known binding partners like ATRAP

Structural Validation:

  • Circular dichroism to assess secondary structure

  • Limited proteolysis to evaluate proper folding

The table below summarizes validated antibodies that could be used for AGTR1 detection:

CodeProduct NameSpecies ReactivityApplication
CSB-PA007848AGTR1 AntibodyHuman, Mouse, RatWB, IHC, IF, ELISA
CSB-PA586539AGTR1 AntibodyHuman, RatELISA, WB
CSB-PA943276AGTR1 AntibodyHuman, RatELISA, WB
CSB-PA001465LA01HUAGTR1 AntibodyHuman, MouseELISA, WB, IHC, IF
CSB-RA257443A0HUAGTR1 Recombinant Monoclonal AntibodyHumanELISA, WB

Depending on sequence homology, these antibodies may cross-react with sheep AGTR1 .

How can transgenic models be used to study AGTR1 function in vivo?

Transgenic models offer powerful tools for investigating AGTR1 function in physiological and pathological contexts. Based on existing research approaches, several strategies for developing and utilizing such models include:

BAC Transgenic Reporter Systems:
Similar to the Agtr1a-EGFP mouse line described in the literature, researchers can develop transgenic sheep models expressing fluorescently tagged AGTR1. This approach allows for visualization of receptor distribution and trafficking in real-time . The insertion technique involves placing the EGFP sequence at the start site for AGTR1 via homologous recombination, resulting in expression of the fluorescent protein under the control of the endogenous AGTR1 promoter.

Conditional Knockout Models:
Utilizing Cre-Lox recombination systems to generate tissue-specific AGTR1 deletion models. This approach has been successfully implemented for AT1AR in mice, where SFO-targeted injection of adenovirus expressing Cre-recombinase was used to create conditional deletions .

Transgenic Protein Expression:
While not directly related to AGTR1, the methodology used for transgenic sheep producing human proteins like alpha-1-antitrypsin demonstrates the feasibility of creating sheep models expressing modified versions of AGTR1 for functional studies .

Transgenic models enable investigations of receptor function in complex physiological systems, providing insights into tissue-specific roles and systemic effects of AGTR1 signaling.

What methodologies can reveal signal transduction pathways activated by sheep AGTR1?

Elucidating the signal transduction pathways activated by sheep AGTR1 requires a multi-faceted approach:

Phosphoproteomic Analysis:
Mass spectrometry-based phosphoproteomics can identify proteins phosphorylated following AGTR1 activation, revealing downstream signaling cascades. This technique can detect both canonical pathways (e.g., PI3K/Akt and Ras/MAPK) and novel signaling components .

Real-time Imaging Techniques:
Fluorescence resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) assays using tagged signaling molecules can monitor protein-protein interactions in living cells following receptor activation. Similar approaches to those used for tracking ATRAP vesicle translocation could be adapted for studying AGTR1 signaling dynamics .

Transcriptomic Profiling:
RNA sequencing following receptor activation identifies genes whose expression is altered, providing insights into transcriptional regulation mediated by AGTR1 signaling.

Pharmacological Dissection:
Specific inhibitors targeting different components of signaling pathways (e.g., PI3K inhibitors, MAPK inhibitors) help delineate the contribution of each pathway to AGTR1-mediated effects.

These complementary approaches provide a comprehensive view of the signaling networks regulated by sheep AGTR1, facilitating comparative analyses with human AGTR1 signaling.

How does AGTR1 interact with regulatory proteins like ATRAP in different species?

The interaction between AGTR1 and regulatory proteins, particularly ATRAP (AT1 receptor-associated protein), exhibits both conserved and species-specific features:

ATRAP binds specifically to the carboxyl-terminal cytoplasmic domain of the AT1 receptor across species. This interaction is functionally significant as ATRAP modulates angiotensin II-induced signal transduction . The structural basis for this interaction involves the hydrophilic cytoplasmic carboxyl-terminal tail of ATRAP (residues 109-161) binding to the C-terminal region of AGTR1.

Mutant forms of ATRAP lacking the carboxyl end are unable to bind to the AT1 receptor, confirming the importance of this domain for protein-protein interaction . Species-specific variations in the C-terminal sequence of AGTR1 may affect the binding affinity and functional consequences of ATRAP interaction.

In cellular contexts, ATRAP colocalizes with AGTR1 in intracellular vesicular compartments corresponding to endoplasmic reticulum, Golgi, and endocytic vesicles. Real-time tracking shows constitutive translocation of ATRAP vesicles toward the plasma membrane, suggesting a role in receptor trafficking and recycling .

Comparative analysis of AGTR1-ATRAP interactions across species provides insights into conserved regulatory mechanisms and potential therapeutic targets for modulating AGTR1 signaling.

What are common challenges in expressing functional recombinant sheep AGTR1 and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant AGTR1:

Low Expression Levels:
GPCR expression is often limited by cellular toxicity and poor membrane integration.

  • Solution: Optimize codon usage for the expression system, use inducible expression systems, and consider fusion partners that enhance membrane targeting.

  • Example: The BAC transgenic approach used for mouse Agtr1a-EGFP, which involves insertion of 4-8 BACs at a single random site, demonstrates one strategy for achieving appropriate expression levels .

Improper Folding:
Misfolded receptors fail to traffic to the plasma membrane and may aggregate in the endoplasmic reticulum.

  • Solution: Expression at lower temperatures (28-32°C), addition of chemical chaperones, and use of specialized host cells with modified chaperone systems.

Post-translational Modifications:
Lack of appropriate glycosylation and disulfide bond formation affects receptor function.

  • Solution: Use mammalian expression systems that provide the necessary cellular machinery for proper post-translational processing.

Receptor Stability:
AGTR1 may be unstable during purification and functional assays.

  • Solution: Develop stabilized receptor constructs through rational mutagenesis or directed evolution approaches, similar to those used for other GPCRs.

Addressing these challenges requires an integrated approach combining molecular biology techniques with biochemical and cell biological methods tailored to the specific properties of sheep AGTR1.

How can researchers address discrepancies between in vitro and in vivo data for AGTR1 function?

Discrepancies between in vitro and in vivo findings are common in AGTR1 research and require careful interpretation:

Contextual Differences:
In vitro systems lack the complex cellular and tissue environment present in vivo.

  • Resolution Strategy: Develop more complex in vitro models incorporating co-culture systems or organoids that better mimic the in vivo context.

Receptor Expression Levels:
Overexpression in vitro may lead to constitutive activity or non-physiological signaling.

  • Resolution Strategy: Use expression systems with controllable expression levels and compare results across different expression levels. The approach used in the Agtr1a-EGFP transgenic mice, where EGFP expression is controlled by the endogenous promoter, provides a model for physiologically relevant expression .

Signaling Component Differences:
Cell lines used for in vitro studies may lack key signaling components present in target tissues.

  • Resolution Strategy: Characterize the expression of signaling components in the chosen cell system and supplement missing factors where possible.

Species Differences:
When extrapolating between species (e.g., from sheep to human), protein sequence variations may affect function.

  • Resolution Strategy: Perform comparative studies with receptors from different species and identify conserved and divergent responses. Consider the approach used for validating antibodies that recognize the AT1 receptor, which involved testing against different AT1 receptor subtypes .

Rigorous validation using multiple methodologies and careful consideration of experimental context are essential for reconciling disparate findings between in vitro and in vivo systems.

What considerations are important when interpreting immunological data for sheep AGTR1 detection?

Interpreting immunological data for sheep AGTR1 requires careful attention to several factors:

Antibody Specificity:
Cross-reactivity with other proteins, particularly the closely related AT2 receptor, can confound results.

  • Validation Approach: Perform preadsorption controls with antigenic peptides to confirm specificity. For example, preadsorption of an AT1 receptor antibody with its antigenic peptide completely removed punctate immunolabeling in rat brain sections .

  • Additional Controls: Test antibodies in tissues from AGTR1 knockout models or in cells with conditional deletion of AGTR1, as demonstrated for AT1AR in mice with SFO-targeted deletion .

Epitope Accessibility:
The conformation of AGTR1 and potential masking by interacting proteins can affect antibody binding.

  • Solution: Use multiple antibodies targeting different epitopes and compare results across different sample preparation methods.

Fixation and Processing Effects:
Different fixation methods can alter epitope structure and antibody recognition.

  • Recommendation: Optimize fixation protocols for specific antibodies and always include appropriate positive and negative controls.

The table below provides a framework for validating immunological detection methods:

Validation StepMethodExpected Outcome
SpecificityPreadsorption with antigenic peptideElimination of specific signal
SensitivityTitration seriesDetermination of optimal antibody concentration
ReproducibilityMultiple technical and biological replicatesConsistent detection patterns
Cross-validationMultiple antibodies targeting different epitopesConcordant results across antibodies
Genetic validationTesting in knockout/knockdown modelsAbsence of signal in genetic models

These rigorous validation steps ensure reliable interpretation of immunological data for sheep AGTR1.

What emerging technologies might advance our understanding of sheep AGTR1 structure and function?

Several cutting-edge technologies hold promise for advancing sheep AGTR1 research:

Cryo-Electron Microscopy:
Recent advances in cryo-EM have revolutionized GPCR structural biology, enabling determination of receptor structures in different conformational states. Applying this technique to sheep AGTR1 could reveal species-specific structural features and conformational dynamics.

CRISPR/Cas9 Genome Editing:
Precise modification of the sheep AGTR1 gene allows creation of models with specific mutations or tagged receptors expressed at endogenous levels. This approach overcomes limitations of traditional transgenic methods like those used for the Agtr1a-EGFP mouse line .

Single-Cell Technologies:
Single-cell RNA sequencing and proteomics provide unprecedented resolution of AGTR1 expression patterns and signaling responses in heterogeneous tissues. These approaches could identify cell populations with unique AGTR1 signaling properties.

Spatial Transcriptomics and Proteomics:
These techniques preserve spatial information while analyzing gene and protein expression, offering insights into the tissue-specific microenvironments that influence AGTR1 function.

Optogenetic and Chemogenetic Tools:
These approaches enable precise temporal control of AGTR1 activation, facilitating studies of downstream signaling dynamics and physiological responses.

Integration of these technologies with established research methods will provide a more comprehensive understanding of sheep AGTR1 biology and its relevance to human physiology and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.