Recombinant Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Sheep V-Type Proton ATPase 16 kDa Proteolipid Subunit (ATP6V0C)

The Recombinant Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) is a recombinant protein derived from the sheep ATP6V0C gene, encoding a critical component of the vacuolar-type ATPase (V-ATPase) complex. This protein is part of the V₀ domain, which facilitates proton transport across cellular membranes to acidify intracellular compartments such as lysosomes, endosomes, and secretory vesicles .

Critical Domains

DomainRole
Transmembrane (TM) 2Interacts with ATP6V0A to coordinate proton channel activity
Transmembrane (TM) 4Contains a hotspot for pathogenic mutations (e.g., p.A138P, p.L150F)
C-TerminusBinds to ubiquitin ligases, influencing protein stability and trafficking

Functional Studies

Recombinant ATP6V0C is used to study V-ATPase assembly, proton transport efficiency, and disease mechanisms. For example:

  • Human Disease Models: Heterozygous ATP6V0C mutations (e.g., p.A138P, p.L150F) impair V-ATPase activity, leading to neurodevelopmental disorders, epilepsy, and intellectual disability .

  • Mouse Knockout Models: Atp6v0c deletion disrupts epithelial cell polarity during embryogenesis, highlighting its role in developmental processes .

Clinical Relevance

Study TypeKey Findings
Human Genetic ScreensATP6V0C variants identified in 27 patients with epilepsy and developmental delay .
Cellular AssaysMissense variants (e.g., p.Ala22Thr) reduce ATP6V0C’s ability to bind ATP6V0A, disrupting proton transport .
Structural AnalysisMutations in TM domains (e.g., p.A138P) alter c-ring rotational mechanics .

Expression and Purification

  • Expression: Full-length ATP6V0C (1–155aa) is typically expressed in E. coli, followed by Ni-NTA affinity chromatography due to the His-tag .

  • Validation: Purity is confirmed via SDS-PAGE, and functionality is assessed using proton transport assays or co-IP with V-ATPase subunits .

Limitations

  • Species Specificity: Sheep ATP6V0C may exhibit structural differences compared to human homologs, requiring cross-species validation .

  • Membrane Integration: Recombinant ATP6V0C requires lipid reconstitution for functional studies, as it is produced in a soluble form .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP6V0C; ATP6C; ATP6L; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; Vacuolar proton pump 16 kDa proteolipid subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
Full length protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
MSEAKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEMIMKSIIPVV MAGIIAIYGLVVAVLIANSLNDGISLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Uniprot No.

Target Background

Function
Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Database Links

KEGG: oas:443003

UniGene: Oar.561

Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is ATP6V0C and what is its function in cellular physiology?

ATP6V0C encodes the V-type proton ATPase 16 kDa proteolipid subunit, which forms the proton-conducting pore in the membrane integral V0 complex of vacuolar ATPase (V-ATPase). This protein plays a critical role in acidifying various intracellular compartments in eukaryotic cells . The V-ATPase complex functions as a proton pump, creating an electrochemical gradient across organellar membranes by transporting protons from the cytosol into the lumen of organelles. This acidification process is essential for numerous cellular functions including protein sorting, receptor-mediated endocytosis, and the activation of lysosomal enzymes. In sheep, as in other mammals, ATP6V0C maintains similar structural and functional characteristics that are highly conserved across species due to the protein's fundamental role in cellular homeostasis .

How does sheep ATP6V0C compare structurally to its homologs in other species?

Sheep ATP6V0C shares high sequence homology with its homologs in other mammalian species, reflecting the protein's evolutionary conservation due to its essential cellular functions. The protein consists of 155 amino acid residues, with exons 2 and 3 encoding 62 and 67 amino acids respectively . When comparing the recombinant versions available for research, recombinant proteins from bovine, human, mouse, rat, and sheep sources are all commercially available with similar molecular weights (approximately 16 kDa) . The high conservation of this protein across species suggests that findings from studies using recombinant sheep ATP6V0C may be translatable to other mammalian systems, although species-specific post-translational modifications might exist and should be considered when designing cross-species experiments.

What expression systems are typically used for producing recombinant sheep ATP6V0C?

Multiple expression systems are employed for producing recombinant sheep ATP6V0C, each with distinct advantages depending on research requirements. The primary expression systems include:

Expression SystemAdvantagesCommon Applications
E. coli (in vitro)High yield, cost-effective, rapid productionStructural studies, antibody production
YeastPost-translational modifications, proper foldingFunctional studies requiring eukaryotic processing
BaculovirusHigher eukaryotic processing, large proteinsComplex functional assays, interaction studies
Mammalian cellNative-like modifications, proper foldingSignaling studies, therapeutic applications
In Vivo BiotinylationSite-specific labeling for detectionProtein-protein interaction studies

The in vitro E. coli expression system is commonly used for basic research applications, while mammalian cell expression systems may be preferred when native conformation and post-translational modifications are critical for experimental outcomes .

How can recombinant sheep ATP6V0C be utilized in studies of epithelial cell polarity?

Recombinant sheep ATP6V0C serves as a valuable tool for investigating epithelial cell polarity, particularly given the critical role of V-ATPase in maintaining apical-basal polarity. Research has demonstrated that absence of ATP6V0C in mouse embryos severely disrupts epithelial organization, specifically affecting apical-basal polarity in the visceral endoderm layer . For polarity studies, researchers can employ recombinant sheep ATP6V0C in several methodological approaches:

  • Rescue experiments in ATP6V0C-deficient cell lines to assess functional conservation across species

  • Protein localization studies using fluorescently tagged recombinant ATP6V0C to track subcellular distribution during polarity establishment

  • Co-immunoprecipitation experiments to identify polarity-related binding partners using biotinylated versions of the recombinant protein

  • Domain-specific mutagenesis to identify regions essential for polarity maintenance

When conducting these experiments, it is crucial to consider that Na⁺/K⁺-ATPase has been observed to localize to the apical surface in wild-type visceral endoderm, contrary to its typical basolateral restriction in most epithelia . This unusual distribution pattern suggests tissue-specific interactions that may involve ATP6V0C, which researchers should account for when designing experiments and interpreting results.

What methodological considerations are important when using recombinant sheep ATP6V0C for acidification studies?

When utilizing recombinant sheep ATP6V0C for acidification studies, several methodological considerations are critical for experimental success:

  • Reconstitution protocols: For functional studies, the recombinant protein must be properly reconstituted into lipid bilayers or liposomes to maintain its native conformation. The lipid composition significantly impacts protein activity and should mimic the natural membrane environment of V-ATPase.

  • ATP concentration optimization: As an ATPase, the protein requires ATP for activity. Researchers should establish optimal ATP concentrations through titration experiments to ensure maximum activity without substrate inhibition.

  • pH indicators: Employing pH-sensitive fluorescent dyes (such as BCECF or LysoSensor) allows for real-time monitoring of proton pumping activity. Alternatively, pH-sensitive microelectrodes can provide precise measurements in reconstituted systems.

  • Control experiments: Parallel experiments with specific V-ATPase inhibitors (such as bafilomycin A1 or concanamycin A) are essential to confirm that observed acidification is specifically due to ATP6V0C activity rather than other proton transporters that might contaminate the preparation.

  • Source considerations: While the E. coli-expressed protein is more readily available, studies requiring fully functional protein may benefit from eukaryotic expression systems that provide appropriate post-translational modifications .

How does ATP6V0C contribute to embryonic development, and what experimental approaches can be used to study this process?

ATP6V0C plays a crucial role in embryonic development, particularly in establishing and maintaining epithelial cell polarity during early embryogenesis. Research has shown that ATP6V0C-deficient mouse embryos develop severe defects in epithelial tissue organization, despite initially differentiating embryonic epithelial tissues, primitive endoderm, epiblast, and extraembryonic ectoderm . To study ATP6V0C's role in development, researchers can employ several experimental approaches:

  • Conditional knockout models: Generating tissue-specific or temporally controlled ATP6V0C knockouts allows for precise examination of its function at different developmental stages without the early lethality associated with complete knockout.

  • Chimeric embryo analysis: Creating chimeric embryos with both wild-type and ATP6V0C-deficient cells helps determine cell-autonomous versus non-cell-autonomous effects on development.

  • Live imaging techniques: Using fluorescently tagged recombinant sheep ATP6V0C enables real-time visualization of protein localization and dynamics during developmental processes.

  • Transcriptomic and proteomic profiling: Comparing wild-type and ATP6V0C-deficient embryos at various developmental stages identifies downstream molecular pathways affected by V-ATPase activity.

  • Cross-species rescue experiments: Testing whether recombinant sheep ATP6V0C can rescue developmental defects in ATP6V0C-deficient mouse embryos assesses functional conservation between species.

The severe phenotype observed in ATP6V0C-deficient embryos, characterized by abnormal epithelial morphology and impaired apical-basal polarity in the visceral endoderm layer, underscores the protein's fundamental importance in early development .

What are the optimal storage and handling conditions for recombinant sheep ATP6V0C?

Proper storage and handling of recombinant sheep ATP6V0C is critical for maintaining protein stability and functionality. The recommended protocols are:

Storage ConditionTemperatureDurationAdditives
Long-term storage-80°CUp to 1 year10-20% glycerol
Medium-term storage-20°C1-3 months10% glycerol
Working solution4°C1-2 weeks1 mM DTT or 5 mM β-mercaptoethanol
Experimental useOn ice<8 hoursN/A

For optimal results, researchers should avoid repeated freeze-thaw cycles, which can significantly degrade protein quality. Aliquoting the protein upon receipt is recommended, with each aliquot sized appropriately for single-use applications. Additionally, the protein should be maintained in a slightly acidic buffer (pH 6.5-7.0) to better mimic its native environment in acidified compartments . When handling the protein for reconstitution experiments, detergent selection is crucial—mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) at concentrations just above critical micelle concentration help maintain protein structure while allowing incorporation into artificial membranes or liposomes.

What controls should be included when conducting immunoassays using recombinant sheep ATP6V0C?

When designing immunoassays with recombinant sheep ATP6V0C, comprehensive controls are essential for result validation and experimental troubleshooting:

  • Positive controls: Include commercially available recombinant ATP6V0C from a different expression system to verify antibody specificity and assay performance. When possible, native protein extracted from sheep tissues provides an ideal positive control.

  • Negative controls: Use recombinant proteins with similar molecular weights but different sequences to confirm antibody specificity. Additionally, samples from ATP6V0C-knockout tissues or cells (if available) serve as excellent negative controls.

  • Cross-reactivity controls: Test antibodies against recombinant ATP6V0C from different species (human, mouse, rat) to assess species specificity and potential cross-reactivity, particularly important when working with polyclonal antibodies .

  • Loading controls: For Western blots or similar applications, include housekeeping proteins or total protein staining to normalize loading variations.

  • Blocking peptide controls: Pre-incubate antibodies with excess recombinant sheep ATP6V0C to demonstrate signal specificity in immunohistochemistry or immunofluorescence applications.

  • Isotype controls: For immunoprecipitation or flow cytometry, include appropriate isotype controls to account for non-specific binding.

Implementing these controls helps distinguish true positive results from technical artifacts, particularly important when working with membrane proteins like ATP6V0C that can present technical challenges in immunoassay applications.

How can recombinant sheep ATP6V0C be effectively reconstituted for functional studies?

Effective reconstitution of recombinant sheep ATP6V0C for functional studies requires careful consideration of lipid composition, protein-to-lipid ratios, and reconstitution methods. The following stepwise protocol represents a methodological approach:

  • Liposome preparation:

    • Combine phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, and cholesterol in a 5:2:1:2 molar ratio to mimic endosomal membrane composition

    • Dissolve lipids in chloroform, evaporate under nitrogen, and rehydrate in reconstitution buffer (20 mM HEPES, 100 mM KCl, pH 7.0)

    • Subject to freeze-thaw cycles (5-10 times) followed by extrusion through a 100 nm filter

  • Protein preparation:

    • Solubilize recombinant sheep ATP6V0C in 1% n-dodecyl-β-D-maltoside (DDM)

    • Centrifuge at 100,000 × g for 30 minutes to remove aggregates

    • Quantify protein concentration using BCA or Bradford assay

  • Reconstitution:

    • Mix solubilized protein with liposomes at protein-to-lipid ratios between 1:100 and 1:1000 (w/w)

    • Add Bio-Beads SM-2 to remove detergent gradually (4 additions over 24 hours)

    • Recover proteoliposomes by ultracentrifugation (150,000 × g for 1 hour)

    • Resuspend in assay buffer appropriate for functional studies

  • Functional verification:

    • Assess protein orientation using protease protection assays

    • Verify proton pumping activity using pH-sensitive fluorescent dyes

    • Conduct ATP hydrolysis assays to confirm enzymatic activity

This methodology ensures that the reconstituted protein maintains its native conformation and functionality, critical for studies investigating V-ATPase activity in controlled environments .

How does recombinant sheep ATP6V0C interact with other V-ATPase subunits in protein complex assembly?

Recombinant sheep ATP6V0C serves as an excellent model for studying V-ATPase complex assembly due to its role as the proteolipid subunit forming the proton-conducting channel within the V0 domain. ATP6V0C monomers assemble into a hexameric ring structure that forms the core of the proton translocation pathway. Understanding these interactions requires sophisticated experimental approaches:

  • Cross-linking studies: Chemical cross-linking coupled with mass spectrometry can identify interaction interfaces between ATP6V0C and other V-ATPase subunits. This approach has revealed that ATP6V0C interacts directly with subunits ATP6V0A, ATP6V0D, and ATP6V1A.

  • Cryo-electron microscopy: Recent structural studies have provided high-resolution models of the V-ATPase complex, showing how ATP6V0C subunits arrange to form the rotary mechanism. These studies demonstrate that the c-ring (composed of ATP6V0C monomers) rotates against the a-subunit (ATP6V0A) to facilitate proton translocation across membranes.

  • Fluorescence resonance energy transfer (FRET): By creating fluorescently labeled recombinant proteins, researchers can monitor real-time assembly and disassembly of the V-ATPase complex in response to cellular signals or experimental manipulations.

  • Mutagenesis studies: Systematic mutation of conserved residues in recombinant sheep ATP6V0C helps identify amino acids critical for subunit interactions and complex stability. The glutamic acid residue at position 139 is particularly important for proton translocation and is highly conserved across species.

Understanding these interactions is crucial because disruptions in V-ATPase assembly are implicated in numerous pathological conditions including osteopetrosis, renal tubular acidosis, and neurodegenerative disorders .

What role does ATP6V0C play in regulating pH-dependent cellular processes beyond acidification?

While ATP6V0C's primary function involves proton pumping and organellar acidification, research has revealed its involvement in numerous pH-dependent cellular processes through both direct and indirect mechanisms:

  • Membrane fusion events: ATP6V0C contributes to membrane fusion independently of its proton pumping activity. Studies suggest that the proteolipid subunits of V-ATPase form a proteolipid pore during fusion events, particularly in neurotransmitter release and endosomal fusion.

  • Nutrient sensing and mTOR signaling: The V-ATPase complex, including ATP6V0C, participates in amino acid sensing by interacting with the Ragulator complex, which regulates mTORC1 activity. This connection links lysosomal acidification to cellular nutrient status and growth control.

  • Wnt signaling modulation: V-ATPase activity influences the endosomal pH, which affects Wnt receptor recycling and signaling strength. ATP6V0C-mediated acidification is essential for proper Wnt signal transduction during development.

  • Autophagy regulation: Proper lysosomal acidification by V-ATPase is required for autophagosome-lysosome fusion and subsequent degradation of autophagic cargo. ATP6V0C deficiency severely impairs autophagic flux.

  • Cell polarity establishment: As demonstrated in embryonic studies, ATP6V0C is crucial for establishing and maintaining epithelial cell polarity. ATP6V0C-deficient embryos show mislocalization of Na⁺/K⁺-ATPase, normally restricted to the apical membrane in visceral endoderm .

These diverse functions highlight ATP6V0C's importance beyond simple acidification, positioning it as a central regulator of numerous cellular processes dependent on proper pH gradients and compartmentalization.

How can recombinant sheep ATP6V0C be used to study species-specific differences in V-ATPase function?

Recombinant sheep ATP6V0C provides a valuable tool for comparative studies examining species-specific aspects of V-ATPase function. Several methodological approaches facilitate such investigations:

  • Complementation studies: Researchers can express recombinant sheep ATP6V0C in ATP6V0C-deficient cells from different species (human, mouse, rat) to assess functional conservation and species-specific differences in rescue efficiency. Quantitative measurements of organellar acidification, cell growth, and V-ATPase assembly can reveal subtle differences in protein function across species.

  • Interactome analysis: Using techniques such as BioID proximity labeling or cross-linking mass spectrometry with recombinant sheep ATP6V0C can identify species-specific interaction partners that may regulate V-ATPase function differently across mammals.

  • Inhibitor sensitivity profiling: Comparing the sensitivity of sheep ATP6V0C to various V-ATPase inhibitors (bafilomycin A1, concanamycin A, archazolid) against orthologs from other species can reveal structural differences in the binding pockets that might be exploited for species-selective targeting.

  • Post-translational modification mapping: Mass spectrometry analysis of recombinant sheep ATP6V0C compared to orthologs from other species can identify differences in phosphorylation, glycosylation, or other modifications that might confer species-specific regulation.

  • Structural biology approaches: Cryo-electron microscopy or X-ray crystallography of recombinant sheep ATP6V0C can reveal species-specific structural features that might influence V-ATPase assembly or function.

These comparative approaches are particularly valuable for veterinary research and for understanding evolutionary adaptations in V-ATPase function across different mammalian lineages .

What are common technical challenges when working with recombinant sheep ATP6V0C and how can they be addressed?

Working with recombinant sheep ATP6V0C presents several technical challenges due to its hydrophobic nature as a membrane protein. Researchers commonly encounter these issues and can implement the following solutions:

ChallengeCauseSolution
Poor solubilityHydrophobic transmembrane domainsUse appropriate detergents (DDM, CHAPS); consider amphipols for detergent-free handling
Protein aggregationImproper folding; detergent mismatchScreen multiple detergents; add glycerol (10-15%); maintain samples at 4°C
Low expression yieldToxicity to expression hostUse tightly regulated inducible systems; express as fusion with solubility tags (MBP, SUMO)
Difficult purificationNon-specific binding to resinsOptimize imidazole concentration in wash buffers; use tandem purification strategies
Loss of activityDenaturation during purificationVerify proper folding by circular dichroism; reconstitute into nanodiscs or liposomes immediately
Poor antibody recognitionEpitope masking by detergentUse conformation-specific antibodies; consider native immunoprecipitation conditions

Additionally, when reconstituting the protein into liposomes for functional studies, inconsistent protein orientation can be addressed by using pH gradient-based reconstitution methods that favor unidirectional insertion. For expression systems, while E. coli-based systems offer high yield, mammalian expression systems may provide more native-like post-translational modifications for certain applications .

How can researchers verify the functional activity of recombinant sheep ATP6V0C?

Verifying the functional activity of recombinant sheep ATP6V0C is essential before conducting detailed experiments. Several complementary approaches provide comprehensive functional assessment:

  • ATP hydrolysis assay: Although ATP6V0C alone does not hydrolyze ATP, its incorporation into partial or complete V-ATPase complexes enables ATP hydrolysis activity measurements using malachite green assay or enzyme-coupled assays. Bafilomycin A1 sensitivity confirms V-ATPase-specific activity.

  • Proton pumping assays: Reconstituting ATP6V0C into proteoliposomes loaded with pH-sensitive fluorescent dyes (ACMA, pyranine) allows measurement of proton transport across membranes. The fluorescence quenching rate corresponds to proton pumping activity and should be inhibited by V-ATPase-specific inhibitors.

  • Binding partner validation: Co-immunoprecipitation or pull-down assays with other V-ATPase subunits (particularly ATP6V0A) confirm proper folding and interaction capabilities. Surface plasmon resonance provides quantitative binding parameters.

  • Thermal stability assessment: Differential scanning fluorimetry using environment-sensitive dyes (SYPRO Orange) can assess protein stability in various buffer conditions, with properly folded protein showing characteristic melting curves.

  • Functional complementation: Expressing recombinant sheep ATP6V0C in ATP6V0C-deficient cells and measuring restoration of organelle acidification (using LysoTracker or similar dyes) provides a definitive biological activity assessment.

When combined, these approaches provide robust validation of recombinant sheep ATP6V0C functionality before proceeding with more complex experimental applications .

What considerations are important when designing experiments comparing ATP6V0C across different species?

  • Sequence alignment and evolutionary context: Before experimental comparison, conduct thorough sequence alignment and phylogenetic analysis to identify conserved domains and species-specific variations. This bioinformatic foundation helps target specific regions for functional comparison.

  • Expression system consistency: Use identical expression systems for all species variants to minimize system-derived variables. If comparing recombinant sheep ATP6V0C with human or mouse orthologs, express all proteins in the same host (e.g., all in mammalian cells or all in E. coli) to ensure comparable post-translational modifications and folding environments.

  • Structural equivalence verification: Confirm that all recombinant proteins adopt similar secondary and tertiary structures using circular dichroism spectroscopy or thermal stability assays before making functional comparisons.

  • Experimental condition optimization: Test multiple pH values, ion concentrations, and temperature conditions, as optimal conditions may vary between species due to evolutionary adaptations to different physiological environments.

  • Interaction network mapping: Beyond direct protein function, compare interaction partners across species using identical proteomic approaches to identify species-specific regulatory mechanisms.

  • Inhibitor cross-reactivity: When using pharmacological tools, establish complete inhibitor dose-response curves for each species variant, as inhibitor sensitivity may vary despite high sequence conservation.

  • Statistical approach: Use paired statistical tests when possible, treating each species variant as its own control under identical conditions to minimize experimental variation .

What are the future research directions for ATP6V0C in developmental biology?

The fundamental role of ATP6V0C in embryonic development, particularly in establishing epithelial cell polarity, opens numerous avenues for future research. Key directions include:

  • Tissue-specific functions: Investigating how ATP6V0C contributes to development of specific tissues and organs beyond early embryogenesis using conditional knockout approaches.

  • Regulatory networks: Elucidating the transcriptional and post-translational regulatory mechanisms that control ATP6V0C expression and activity during different developmental stages.

  • Interspecies developmental differences: Comparing the developmental roles of ATP6V0C across mammalian species to understand evolutionary conservation and specialization.

  • Therapeutic applications: Exploring potential interventions targeting ATP6V0C to correct developmental disorders associated with epithelial polarity defects.

  • Integration with signaling pathways: Investigating how ATP6V0C-mediated acidification interfaces with major developmental signaling pathways including Wnt, Notch, and Hedgehog.

The observation that ATP6V0C deficiency severely disrupts epithelial morphology and apical-basal polarity in the visceral endoderm layer of mouse embryos highlights its critical importance in developmental processes . Future research will likely focus on understanding the molecular mechanisms by which V-ATPase activity influences cell polarity establishment and maintenance, potentially revealing new principles of developmental biology with implications for regenerative medicine.

How do findings from recombinant protein studies translate to in vivo systems?

Translating findings from recombinant protein studies to in vivo systems requires careful consideration of several factors:

  • Physiological context: Recombinant sheep ATP6V0C studied in isolation or reconstituted systems lacks the complex regulatory networks present in vivo. Researchers must validate key findings using cell culture systems and animal models where the protein functions within its natural context.

  • Expression level considerations: Studies using recombinant proteins often employ supraphysiological concentrations that may not reflect in vivo conditions. Quantitative comparisons with endogenous expression levels help contextualize findings.

  • Interaction landscape: In vivo, ATP6V0C functions as part of the V-ATPase complex and potentially interacts with numerous regulatory proteins. Comprehensive interaction mapping in physiological settings complements recombinant protein studies.

  • Post-translational modifications: The pattern and dynamics of post-translational modifications on recombinant proteins may differ from those in vivo, potentially affecting function. Mass spectrometry analysis of endogenous ATP6V0C provides important comparative data.

  • Tissue-specific variations: Different tissues may express splice variants or contain tissue-specific interaction partners that influence ATP6V0C function. Tissue-specific validation is essential for comprehensive understanding.

The severe phenotypic consequences of ATP6V0C deficiency in mouse embryos underscore the protein's critical in vivo functions that may not be fully recapitulated in reconstituted systems . Integrative approaches combining recombinant protein studies with cellular and organismal models provide the most comprehensive understanding of ATP6V0C biology.

What collaborative research opportunities exist between different fields studying ATP6V0C?

ATP6V0C's fundamental role in cellular physiology creates numerous opportunities for interdisciplinary collaboration:

  • Developmental biology and structural biology: Combining high-resolution structural studies of recombinant sheep ATP6V0C with developmental phenotyping of ATP6V0C mutations can reveal structure-function relationships crucial for embryonic development.

  • Comparative physiology and evolutionary biology: Collaborative studies of ATP6V0C across different species can illuminate how evolutionary pressures have shaped V-ATPase function in different ecological niches.

  • Cell biology and systems biology: Integrating proteomic interaction networks of ATP6V0C with dynamic cellular imaging could reveal how V-ATPase activity coordinates with other cellular systems during processes like endocytosis and autophagy.

  • Neuroscience and membrane biophysics: Joint investigation of ATP6V0C's role in synaptic vesicle acidification and neurotransmitter loading connects fundamental membrane biophysics with higher neurological functions.

  • Immunology and cell physiology: Exploring ATP6V0C's role in antigen processing and presentation bridges basic V-ATPase biology with immunological applications.

  • Pharmacology and structural biology: Collaborative development of ATP6V0C-targeted compounds could yield new research tools and potential therapeutics for conditions involving disrupted pH regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.