Recombinant Sheep Vitamin K-dependent gamma-carboxylase (GGCX)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Background

Recombinant Sheep Vitamin K-Dependent Gamma-Carboxylase (GGCX) is a genetically engineered enzyme produced in Escherichia coli for research applications. This 758-amino-acid protein (UniProt ID: Q9GL59) facilitates the post-translational γ-carboxylation of glutamate residues in vitamin K-dependent proteins (VKDPs), a critical step for their biological activity in blood coagulation, bone metabolism, and vascular calcification . The recombinant form includes a His-tag for purification and retains functional domains essential for substrate recognition and catalytic activity .

Enzyme Activity and Substrate Specificity

GGCX carboxylates VKDPs using KH<sub>2</sub> as a cofactor, converting glutamate (Glu) to γ-carboxyglutamate (Gla). Key functional observations include:

  • Coagulation Factors: Mutations (e.g., D153G) reduce carboxylation efficiency, leading to bleeding disorders .

  • Non-Coagulation Proteins: Impaired matrix Gla protein (MGP) carboxylation causes vascular calcification (Keutel syndrome) .

  • Vitamin K Dependency: Higher vitamin K concentrations partially restore coagulation factor carboxylation but not MGP carboxylation in mutants .

Table 2: Functional Impact of GGCX Mutations in Sheep

MutationPhenotypeVitamin K ResponseReference
R686StopTruncated protein; fatal coagulopathyNo improvement with K1
R486HNormal enzyme activityN/A
D153GReduced factor II, VII, IX, XPartial recovery at high K

Mechanistic Studies

  • Cell-Based Assays: HEK293 cells with CRISPR-Cas9 GGCX knockouts express recombinant sheep GGCX to study carboxylation kinetics .

  • Propeptide Engineering: Substituting residues (e.g., V-6L in FIX propeptide) enhances carboxylation efficiency 20-fold .

Disease Modeling

  • Coagulopathies: The R686Stop mutation in Rambouillet sheep provides a model for studying GGCX deficiency .

  • Drug Screening: Recombinant GGCX enables high-throughput testing of vitamin K analogs and anticoagulants .

Production and Quality Control

The recombinant enzyme is lyophilized for stability and reconstituted in glycerol-containing buffers. Critical quality metrics include:

  • Activity Validation: Measured via <sup>14</sup>CO<sub>2</sub> incorporation assays .

  • Purity Assurance: SDS-PAGE and mass spectrometry confirm >90% homogeneity .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve substrate-binding mechanisms.

  • Therapeutic Development: Optimizing vitamin K dosing to rescue mutant GGCX activity in vivo .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage (up to one week), store working aliquots at 4°C.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting is recommended for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
GGCX; Vitamin K-dependent gamma-carboxylase; Gamma-glutamyl carboxylase; Peptidyl-glutamate 4-carboxylase; Vitamin K gamma glutamyl carboxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-758
Protein Length
Full Length of Mature Protein
Species
Ovis aries (Sheep)
Target Names
Target Protein Sequence
AVSARPARAPRGPDKVKKDKAAQTSGPRQGSQMGKLLGFEWTDVSSWERLVTLLNRPTDP ASLAVFRFLFGLMMVLDIPQERGLSSLDRRYLDGLEVCRFPLLDALQPLPLDWMYLVYTI MFLGALGMMLGLCYRISCVLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFVDAHHYWS VDGLLRARKRNAHVPLWNYAVLRGQIFIVYFIAGIKKLDADWVEGYSMEYLSRHWLFSPF KLVLSEEMTSLLVVHWCGLLLDLSAGFLLFFDASRPIGFVFVSYFHCMNSQLFSIGMFPY VMLASSPLFCSPEWPRKLVAHCPKKLQELLPLRTAPQPSTSCMYKRSRARGSQKPGLRHQ LSTAFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTG ELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRI FDPRVDIVQAAWSPFQRTPWLQPLLMDLSPWRTKLQEIKSSLDNHTEVVFIADFPGLHLE NFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLQEGEKMQLPAGEYHKVYTVSSSPSCYMY IYVNTTEVALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLR RQQRLQEIERRRNAPFYERFVRFLLRKLFIFRRSFLMTCISLRNLALGRPSLEQLAQEVT YANLRPFEPAGEPSPVNTDSSNPNPPEPDSHPVHSEF
Uniprot No.

Target Background

Function
This enzyme facilitates the vitamin K-dependent carboxylation of glutamate residues, converting them into calcium-binding gamma-carboxyglutamate (Gla) residues. Simultaneously, it converts the reduced hydroquinone form of vitamin K to vitamin K epoxide.
Database Links

KEGG: oas:443129

UniGene: Oar.788

Protein Families
Vitamin K-dependent gamma-carboxylase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the role of GGCX in sheep coagulation and why is it important for research?

Gamma-glutamyl carboxylase (GGCX) is a critical enzyme involved in the post-translational modification of several vitamin K-dependent proteins, particularly coagulation factors II, VII, IX, and X. In sheep, as in other mammals, GGCX facilitates the carboxylation of glutamic acid residues to gamma-carboxyglutamic acid, which is essential for calcium binding and functional activity of these proteins. Research findings from Rambouillet sheep demonstrate that decreased GGCX activity directly results in reduced activity of coagulation factors II, VII, IX, and X, leading to ineffective hemostasis and potentially fatal coagulopathy . The significance of studying sheep GGCX lies in understanding enzyme function across species and developing animal models for human coagulation disorders, as the sheep model represents the only known animal model of defective GGCX activity .

How does the structure of sheep GGCX compare to human GGCX?

Sheep GGCX shares significant sequence homology with human GGCX, making it a valuable model for comparative studies. The full-length ovine GGCX cDNA consists of 2345 base pairs spanning 15 exons, similar to the human counterpart . Structural analysis of the ovine GGCX indicates conservation of functional domains critical for vitamin K-dependent carboxylation. Research has characterized specific regions of the enzyme, including the propeptide binding site and the catalytic domain. When working with recombinant sheep GGCX, researchers should consider these structural similarities while accounting for species-specific variations that may affect experimental outcomes and interpretation of results.

What is the significance of the R686Stop mutation in sheep GGCX?

The R686Stop mutation (SNP-4) in sheep GGCX results in a premature termination codon that truncates the protein at residue 686, significantly reducing enzymatic activity. This mutation was identified in a flock of Rambouillet sheep experiencing increased lamb mortality due to ineffective hemostasis at parturition . Genetically, this mutation is represented by a C/T substitution in exon 14 resulting in an arginine to stop codon (UGA) substitution . The GATT/GATT genotype has a strong association with the observed coagulopathy (P < 0.001) . This mutation provides a natural animal model for studying GGCX deficiency, allowing researchers to investigate the functional consequences of C-terminal truncation on enzyme activity, substrate recognition, and vitamin K metabolism in vivo.

What experimental approaches are optimal for expressing and purifying recombinant sheep GGCX?

Optimal expression of recombinant sheep GGCX typically involves eukaryotic expression systems such as insect cells (using baculovirus vectors) or mammalian cell lines (HEK293 or CHO cells) to ensure proper post-translational modifications and membrane insertion. Based on the methodologies used for native GGCX analysis, recombinant constructs should be designed with consideration of the full 2345 bp cDNA sequence, potentially including affinity tags for purification while ensuring these do not interfere with enzyme activity . Purification protocols should utilize gentle detergent solubilization (such as CHAPS or digitonin) to maintain enzymatic activity, followed by affinity chromatography. When expressing mutant variants, researchers should consider the R686Stop mutation identified in Rambouillet sheep as a critical negative control, as this truncation severely impairs GGCX activity . Experimental designs should incorporate activity assays using synthetic peptide substrates to verify functional expression.

How do single nucleotide polymorphisms (SNPs) in sheep GGCX affect enzyme function and experimental outcomes?

Research has identified multiple SNPs in sheep GGCX that may influence experimental outcomes when working with recombinant forms. Four significant SNPs (2-5) have been characterized in Rambouillet sheep :

  • SNP-2: Located in intron 10, with unclear functional significance

  • SNP-3: Located in exon 11, resulting in R486H substitution

  • SNP-4: Located in exon 14, causing R686Stop truncation

  • SNP-5: Located in intron 14, with unclear functional significance

The R686Stop mutation (SNP-4) significantly impacts enzyme function, while the R486H substitution (SNP-3) does not measurably affect GGCX activity, as demonstrated by comparable enzyme activity in hepatic microsomes from sheep homozygous for this mutation (GACC/GACC) versus control sheep (TGCC/TGCC) . When designing recombinant GGCX constructs, researchers should be aware of these polymorphisms and their potential effects on experimental outcomes, particularly when comparing data across different sheep breeds or when developing structure-function studies.

What are the substrate specificity differences between sheep GGCX and other species?

Sheep GGCX exhibits substrate specificity patterns that may differ from other species, particularly in the carboxylation efficiency for different vitamin K-dependent proteins. Research findings suggest variable carboxylation rates across different coagulation factors - with Factor IX being most severely affected in GGCX-deficient sheep, followed by Factor X, Factor VII, and Factor II . This variability likely reflects differences in propeptide binding affinity and substrate turnover rates. The table below illustrates the differential impact on coagulation factors in affected lambs compared to controls:

Coagulation ParameterAffected LambsControl Lambs
LambsR104R108R102CR108L02CR102L02B145F04
Factor II (%)5575258093NA
Factor VII (%)204057075NA
Factor IX (%)3444935NA
Factor X (%)201167033NA
GGCX activity5991,064925163,696179NA

These findings indicate that when working with recombinant sheep GGCX, researchers should carefully select appropriate substrates for activity assays and consider the differential affinity of the enzyme for various vitamin K-dependent proteins .

What are the most reliable methods for measuring recombinant sheep GGCX activity?

For reliable measurement of recombinant sheep GGCX activity, researchers should employ established carboxylation assays that quantify the conversion of glutamic acid to gamma-carboxyglutamic acid. Based on methodologies used for native sheep GGCX, microsomal preparations containing the recombinant enzyme can be assessed using synthetic peptide substrates (such as FLEEL) in the presence of vitamin K hydroquinone, oxygen, and ^14^CO₂ . The incorporation of radiolabeled carbon dioxide can be measured by liquid scintillation counting after acid precipitation of the reaction products. Alternatively, non-radioactive methods using mass spectrometry can detect gamma-carboxyglutamic acid formation. When establishing these assays, researchers should use appropriate positive controls (normal sheep GGCX) and negative controls (the R686Stop truncated variant) to validate the assay system . Activity measurements should account for substrate concentration, pH, temperature, and cofactor availability to ensure optimal and reproducible results.

How can genetic screening be used to identify and characterize GGCX variants in sheep?

Genetic screening for GGCX variants in sheep can be implemented using PCR-based approaches targeting known SNPs, particularly those associated with functional consequences. Based on established methodologies, researchers should design primers to amplify specific regions of the GGCX gene (such as exons 11 and 14) that contain known functional polymorphisms . The identification of the R686Stop mutation can be facilitated using restriction fragment length polymorphism (RFLP) analysis with BbvI restriction enzyme, which recognizes a site present in normal but not mutant sequences . This creates a distinctive pattern where normal sheep DNA shows two bands after digestion, while affected (homozygous mutant) sheep show only one undigested band . For more comprehensive analysis, sequencing of the entire GGCX coding region (15 exons) should be performed using overlapping amplicons. Next-generation sequencing approaches could also be employed for high-throughput screening across populations to identify novel variants.

What are the challenges in developing stable cell lines expressing recombinant sheep GGCX?

Developing stable cell lines expressing recombinant sheep GGCX presents several challenges that researchers must address. As a membrane-bound enzyme, GGCX requires proper insertion into the endoplasmic reticulum membrane for activity. Expression systems must therefore support appropriate protein trafficking and post-translational modifications. Based on the known characteristics of native GGCX, key considerations include:

  • Selection of appropriate promoters to achieve physiologically relevant expression levels

  • Addition of signal sequences to ensure proper membrane targeting

  • Potential toxicity from overexpression of active carboxylase

  • Selection pressure maintenance to prevent loss of expression over cell passages

  • Verification of functional activity using vitamin K-dependent substrates

Researchers should establish robust quality control measures, including regular genotyping to confirm the absence of spontaneous mutations, particularly the R686Stop mutation, which would render the enzyme non-functional . Additionally, cell lines should be characterized for endogenous carboxylase activity that might interfere with measurements of the recombinant sheep enzyme. Developing paired cell lines expressing wild-type and mutant variants would provide valuable internal controls for comparative functional studies.

How does vitamin K metabolism interact with sheep GGCX function in experimental systems?

Vitamin K metabolism is intricately linked with GGCX function through the vitamin K cycle. In sheep with the R686Stop mutation, parenteral vitamin K₁ supplementation did not improve vitamin K-dependent coagulation factor activities, indicating that the defect is in the carboxylation machinery rather than vitamin K availability or recycling . This observation is significant for recombinant GGCX research, as it demonstrates that enzyme function cannot be rescued by increasing substrate availability. When designing experiments with recombinant sheep GGCX, researchers should consider the interplay between vitamin K availability, vitamin K epoxide reductase (VKOR) activity, and GGCX function. The affected Rambouillet sheep showed severely reduced hepatic GGCX activity despite adequate vitamin K 2,3-epoxide reductase activity , suggesting that experimental systems should monitor both enzymes to fully understand carboxylation efficiency.

What can computational modeling reveal about sheep GGCX structure-function relationships?

Computational modeling of sheep GGCX can provide valuable insights into structure-function relationships, particularly when experimental structural data may be limited. Using the ovine GGCX sequence data identified in the research studies , homology modeling based on available structural information from human or other mammalian GGCX can predict the impact of mutations like R686Stop on protein folding, substrate binding, and catalytic activity. Models should incorporate the known SNPs and evaluate their potential effects on protein stability and function. For instance, the R486H substitution (SNP-3) that did not measurably impact GGCX activity might be predicted to maintain structural integrity, while the R686Stop mutation would clearly disrupt C-terminal domains essential for function. Molecular dynamics simulations could further explore how these mutations affect protein flexibility, cofactor binding, and interactions with vitamin K-dependent substrates. These computational approaches can guide the design of recombinant GGCX variants with modified properties for experimental investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.