Recombinant Sheeppox virus G-protein coupled receptor homolog Q2/3L (Q2/3L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Q2/3L; G-protein coupled receptor homolog Q2/3L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-381
Protein Length
full length protein
Species
Sheeppox virus (strain KS-1) (SPPV) (Capripoxvirus (strain KS-1))
Target Names
Q2/3L
Target Protein Sequence
MNYTLSTVSSATMYNSSSNITTIATTIISTILSTISTNQNNVTTPSTYENTTTISNYTTA YNTTYYSDDYDDYEVSIVDIPHCDDGVDTTSFGLITLYSTIFFLGLFGNIIVLTVLRKYK IKTIQDMFLLNLTLSDLIFVLVFPFNLYDSIAKQWSLGDCLCKFKAMFYFVGFYNSMSFI TLMSIDRYLAVVHPVKSMPIRTKRYGIVLSMVVWIVSTIESFPIMLFYETKKVYGITYCH VFYNDNAKIWKLFINFEINIFGMIIPLTILLYCYYKILNTLKTSQTKNKKAIKMVFLIVI CSVLFLLPFSVTVFVSSLYLLNVFSGCMALRFVNLAVHVAEIVSLCHCFINPLIYAFCSR EFTKKLLRLRTTSSAGSISIG
Uniprot No.

Target Background

Function
This protein is a putative chemokine receptor.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Host cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing recombinant Q2/3L protein for research purposes?

For recombinant Q2/3L production, E. coli expression systems have been successfully employed to generate His-tagged full-length (1-381) protein . When working with this system, researchers should optimize expression conditions including temperature, induction timing, and IPTG concentration to maximize protein yield while minimizing inclusion body formation. For structural or functional studies requiring proper protein folding, eukaryotic expression systems such as insect cells (baculovirus) or mammalian cells may provide advantages for this transmembrane protein, though these approaches require more complex methodology compared to prokaryotic systems. The choice of expression system should align with the intended downstream applications, considering factors such as required protein folding, post-translational modifications, and scalability needs.

What are the established methods for isolating and characterizing Sheeppox virus strains that express Q2/3L?

Isolation of Sheeppox virus strains expressing Q2/3L can be accomplished using several validated techniques. The primary method involves virus isolation on lamb testis (TA) cells as detailed in OIE protocols . This process includes:

  • Sample preparation: Tissue samples (preferably lung nodules from infected animals) are minced in sterile conditions with medium MEM, followed by filtration (0.45 μm) .

  • Cell infection: Approximately 200 μl of infectious filtrate is used to infect TA cells in 24-well plates .

  • Incubation and observation: Cells are monitored for cytopathic effects (CPE) for 14 days .

  • Verification: Negative samples undergo freeze-thaw cycles, sonication, and centrifugation before re-infecting fresh TA cells for another 14-day observation period .

For molecular characterization, PCR techniques targeting the thymidine kinase (TK) gene and the chemokine analogue receptor of interleukin (IL8) gene have been established . Real-time PCR assays have demonstrated superior sensitivity (91.2%) compared to conventional PCR (64.7%) when testing various clinical samples .

What types of clinical samples are most effective for detecting Q2/3L expression during Sheeppox infection?

The effectiveness of different sample types for detecting Sheeppox virus (and by extension, Q2/3L expression) varies significantly. Based on sensitivity analysis of PCR detection methods, the following sample types are recommended in order of effectiveness:

Type of sampleSensitivity of PCR (%)
Skin crust100 (4/4)
Lung nodule100 (5/5)
Ocular swab96.97 (32/33)
Nasal swab93.94 (31/33)
Rectal swab90.91 (30/33)
Blood66.67 (22/28)

Skin crusts and lung nodules from infected animals provide the highest detection rates (100%), followed closely by ocular swabs (96.97%) . For live animal sampling, ocular swabs represent the optimal balance between high sensitivity and minimal invasiveness. Blood samples demonstrate significantly lower sensitivity (66.67%) and should not be relied upon as the sole diagnostic specimen .

How can researchers validate the functional activity of recombinant Q2/3L protein?

Validation of recombinant Q2/3L functional activity requires multiple complementary approaches:

  • Receptor binding assays: Using labeled ligands (potential chemokines) to assess binding affinity and specificity.

  • G-protein coupling analysis: Measuring downstream signaling events such as calcium mobilization, cAMP production, or ERK/MAPK pathway activation in cells expressing Q2/3L.

  • Comparative analysis: Assessing functional differences between Q2/3L from virulent field isolates versus attenuated vaccine strains by examining receptor activity in standardized cell systems .

  • Mutagenesis studies: Creating targeted mutations in critical receptor domains to identify functional motifs and compare with known GPCR structures.

Each validation approach should include appropriate positive and negative controls to ensure specificity of the observed effects to Q2/3L activity rather than experimental artifacts.

What experimental models are most appropriate for investigating Q2/3L function in sheeppox pathogenesis?

Several experimental models have been validated for investigating Sheeppox virus pathogenesis, which can be adapted to study Q2/3L function specifically:

  • In vitro cell culture models: SFT-R cells and lamb testis (TA) cells have been successfully used for virus propagation and can serve as platforms for Q2/3L expression studies .

  • In vivo sheep infection models: Three established infection routes have demonstrated effectiveness:

    • Intravenous infection: Provides systemic spread of virus

    • Intranasal infection: Mimics natural infection route

    • Contact transmission: Models field transmission between infected and naïve sheep

The choice of model depends on the specific research questions regarding Q2/3L. For mechanistic studies of receptor signaling, in vitro approaches may be sufficient. For understanding the role of Q2/3L in pathogenesis, the in vivo models are more appropriate, with clinical monitoring including:

  • Daily temperature measurements

  • Clinical scoring of symptoms

  • Sample collection (EDTA blood, serum, nasal/oral swabs) at defined intervals (0, 3, 5, 7, 10, 12, 14, 17, 21, and 28 days post-infection)

How can molecular techniques be employed to characterize the interactions between Q2/3L and host immune systems?

Several molecular approaches can elucidate the interactions between Q2/3L and host immune components:

  • Yeast two-hybrid screening: To identify potential host proteins that interact with Q2/3L .

  • Co-immunoprecipitation (Co-IP): To confirm protein-protein interactions under physiological conditions.

  • Pull-down assays: Using purified recombinant His-tagged Q2/3L protein to capture interacting partners from host cell lysates .

  • CRISPR/Cas9 gene editing: To create host cell lines with specific immune pathway modifications to assess the impact on Q2/3L function.

  • Transcriptomics/proteomics: To analyze global changes in host gene/protein expression profiles in response to Q2/3L expression, comparing effects between virulent field isolates and vaccine strains .

These techniques should be employed in relevant cell types, particularly those of ovine origin, to maintain physiological relevance to actual sheeppox infections.

How does the Q2/3L protein sequence vary across different sheeppox virus isolates, and what are the functional implications?

Sequence variation in the Q2/3L protein across different sheeppox virus isolates can be analyzed through comparative genomics approaches. While the provided search results don't specifically address Q2/3L variation, the methodology used for analyzing other SPPV genes can be applied:

  • Full-length genomic sequencing: Using next- and third-generation sequencing to obtain high-quality complete genomes, as demonstrated for SPPV isolates from India (2013) and Egypt (2018) .

  • Hybrid assembly approaches: Combining Illumina and MinION platforms to ensure high accuracy in sequence determination .

  • Targeted gene amplification and sequencing: Similar to methods used for TK and IL8 genes, using specific primers for Q2/3L amplification followed by bidirectional sequencing .

  • Phylogenetic analysis: Comparing Q2/3L sequences with those from related capripoxviruses to establish evolutionary relationships and potential functional divergence .

Functional implications of sequence variations can be assessed through:

  • Identification of conserved domains crucial for receptor function

  • Analysis of selection pressure on different protein regions

  • Correlation of sequence variations with observed differences in virulence between field and vaccine strains

What is the relationship between Q2/3L and related viral GPCRs in other poxviruses?

The Q2/3L protein belongs to a family of viral G-protein coupled receptors found across poxviruses. Comparative analysis with related viral GPCRs can provide insights into conserved functions and virus-specific adaptations. Research approaches should include:

  • Sequence alignment and phylogenetic analysis: To establish evolutionary relationships between Q2/3L and viral GPCRs from related capripoxviruses (goatpox virus, lumpy skin disease virus) and more distant poxviruses .

  • Structural modeling: Using homology modeling based on crystallized GPCR structures to predict structural features and ligand-binding domains of Q2/3L.

  • Functional domain comparison: Identifying conserved signaling motifs versus variable regions that may confer SPPV-specific properties.

  • Host range determinant analysis: Assessing whether differences in Q2/3L sequence correlate with host specificity across the Capripoxvirus genus .

This comparative approach can reveal the degree to which Q2/3L function is conserved or divergent across the poxvirus family, providing insights into its potential contribution to the unique pathogenic properties of SPPV.

How might targeting Q2/3L contribute to novel Sheeppox virus control strategies?

Targeting the Q2/3L protein could represent a novel approach to controlling Sheeppox virus infections. Several strategic avenues exist:

  • Small molecule inhibitors: Designing compounds that specifically block Q2/3L signaling functions by competing for ligand binding or disrupting receptor conformational changes.

  • Neutralizing antibodies: Developing antibodies that recognize extracellular domains of Q2/3L and prevent its interaction with host factors.

  • RNA interference: Using siRNA or antisense oligonucleotides to reduce Q2/3L expression levels during viral infection.

  • Modified vaccine development: Creating attenuated vaccine strains with specific Q2/3L mutations that maintain immunogenicity while reducing virulence, following approaches similar to those used for existing SPPV vaccines .

The development of these approaches requires thorough understanding of Q2/3L structure-function relationships and validation in appropriate experimental models, progressing from in vitro assays to sheep infection models as described previously .

What methodological approaches can determine whether antibodies against Q2/3L provide protection against Sheeppox virus infection?

To evaluate whether anti-Q2/3L antibodies confer protection against Sheeppox virus infection, researchers should employ a multi-stage testing protocol:

  • In vitro neutralization assays: Testing whether antibodies against Q2/3L can neutralize virus infectivity in cell culture systems such as lamb testis cells . Quantification should use established virus titration methods with immunofluorescence detection of viral infection .

  • Passive immunization studies: Administering purified anti-Q2/3L antibodies to sheep before challenge with virulent SPPV strains to assess protection levels.

  • Active immunization with recombinant Q2/3L: Evaluating whether vaccination with purified recombinant Q2/3L protein elicits protective immunity against subsequent viral challenge.

  • Challenge models: Using established intravenous, intranasal, or contact transmission models to evaluate protection under conditions that mimic natural infection.

  • Correlates of protection: Measuring antibody titers, neutralizing activity, and cellular immune responses to determine immunological correlates of protection.

Assessment of protection should include monitoring of clinical parameters such as fever, lesion development, viremia (using validated PCR methods), and viral shedding in various clinical samples as described in previous challenge models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.