Recombinant Shewanella amazonensis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing your order, and we will fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is finalized during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Sama_3650; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Target Names
atpB
Target Protein Sequence
MAATGEALTPQGYIQHHLTNLSVGEGFWTWHIDSLLFSVGLGVLFLWIFRSVGKKATTGV PGKLQCFVEMIVEFVDNSVKETFHGRNALIAPLALTIFVWVFMMNFMDMVPVDWLPHTAA MLGVPYLKVVPTTDLNITFSLALGVFLLIIYYSIKVKGVSGFVKELTLQPFNHWAMIPVN LLLESVTLIAKPISLALRLFGNLYAGELIFILIALMYGANWLIASLGVTLQLGWLIFHIL VITLQAFIFMMLTIVYLSMAHEDH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella amazonensis ATP synthase subunit a (atpB) and what is its significance in bacterial energy metabolism?

ATP synthase subunit a (atpB) from Shewanella amazonensis is a critical component of the bacterial F-type ATP synthase complex, specifically located in the F0 sector embedded within the cell membrane. The protein consists of 264 amino acids and is encoded by the atpB gene (locus name: Sama_3650). As part of the ATP synthase machinery, this subunit plays an essential role in cellular energy production through oxidative phosphorylation .

The subunit a forms part of the proton channel in the F0 sector of ATP synthase, facilitating the flow of protons across the membrane. This proton gradient drives the rotation of the ATP synthase complex, ultimately enabling the synthesis of ATP from ADP and inorganic phosphate. In S. amazonensis, this process is particularly significant as it allows the bacterium to generate energy under various environmental conditions, including those with alternative electron acceptors, a characteristic feature of Shewanella species .

Research on this protein provides valuable insights into bacterial bioenergetics and the evolutionary adaptations that enable S. amazonensis to survive in its natural habitats. The study of bacterial ATP synthases also contributes to our broader understanding of energy conversion mechanisms across different domains of life.

How does the amino acid sequence and structure of S. amazonensis ATP synthase subunit a compare to other bacterial species?

The ATP synthase subunit a from Shewanella amazonensis has a distinct amino acid sequence that shares both similarities and differences with other bacterial homologs. The full sequence (MAATGEALTPQGYIQHHLTNLSVGEGFWTWHIDSLLFSVGLGVLFLWIFRSVGKKATTGVPGKLQCFVEMIVEFVDNSVKETFHGRNALIAPLALTIFVWVFMMNFMDMVPVDWLPHTAAMLGVPYLKVVPTTDLNITFSLALGVFLLIIYYSIKVKGVSGFVKELTLQPFNHWAMIPVNLLLESVTLIAKPISLALRLFGNLYAGELIFILIALMYGANWLIASLGVTLQLGWLIFHILVITLQAFIFMMLTIVYLSMAHEDH) reveals important structural features .

Analysis of this sequence indicates multiple transmembrane regions, consistent with the protein's role in forming a proton channel within the membrane. The N-terminal region contains characteristic motifs that are highly conserved among ATP synthase subunit a proteins across bacterial species. Particularly notable is the conservation of key residues that interact with the c-ring subunits during the rotational catalysis mechanism.

When compared to more distant bacterial species, the sequence diverges more significantly, particularly in the loop regions, while maintaining conservation in the functionally critical transmembrane domains. These evolutionary differences provide valuable insights into the adaptation of the ATP synthase complex across diverse bacterial lineages.

What are the optimal storage and handling conditions for recombinant S. amazonensis ATP synthase subunit a?

Proper storage and handling of recombinant S. amazonensis ATP synthase subunit a are crucial for maintaining its structural integrity and biological activity. Based on established protocols, the following guidelines should be followed:

The recombinant protein is typically supplied in a Tris-based buffer containing 50% glycerol, which helps stabilize the protein structure. For short-term storage (up to one week), the protein can be kept at 4°C, but for extended periods, storage at -20°C is recommended .

For very long-term preservation, -80°C storage is optimal. It is essential to avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of activity. Researchers should aliquot the protein solution into smaller volumes before freezing to minimize the need for multiple freeze-thaw cycles .

When handling the protein, maintain sterile conditions to prevent microbial contamination. Prior to use, centrifuge the protein vial briefly to collect the solution at the bottom of the tube. Thawing should be done gradually on ice rather than at room temperature to prevent localized heating that could denature the protein.

For experimental applications, dilution in appropriate buffers should be performed just before use, and the diluted protein should not be stored for extended periods. The choice of buffer for experimental work should consider the protein's stability at different pH values and ionic strengths, with slightly acidic to neutral pH generally being optimal for maintaining the native conformation of ATP synthase components.

What expression systems and purification strategies are most effective for producing functional recombinant S. amazonensis ATP synthase subunit a?

Producing functional recombinant S. amazonensis ATP synthase subunit a presents several challenges due to its hydrophobic nature and membrane-embedded native state. Based on research protocols, the following expression and purification strategies have proven effective:

Expression Systems:
The Escherichia coli expression system has been successfully used for producing recombinant proteins from Shewanella species. When expressing membrane proteins like ATP synthase subunit a, E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3), often yield better results than standard strains. These strains are engineered to tolerate the toxicity often associated with overexpression of membrane proteins .

Expression vectors incorporating tags that enhance solubility (such as SUMO or MBP) can improve the yield of functional protein. Induction conditions must be carefully optimized; typically, lower temperatures (16-20°C) and reduced inducer concentrations promote proper folding of membrane proteins like ATP synthase subunit a.

Purification Strategies:
Purification generally involves a multi-step approach starting with cell lysis using detergents that effectively solubilize membrane proteins while maintaining their native structure. Mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin are often preferred for ATP synthase components.

Affinity chromatography using the incorporated tag (His, FLAG, etc.) serves as an initial purification step, followed by size exclusion chromatography to separate the target protein from aggregates and other contaminants. Ion exchange chromatography may provide additional purification if needed.

Throughout the purification process, it's crucial to maintain the protein in a buffer containing appropriate detergent concentrations and stabilizing agents to prevent aggregation and preserve functional integrity. The purified protein can then be reconstituted into liposomes for functional studies if membrane-associated activity is being investigated.

How can researchers assess the functional activity of recombinant S. amazonensis ATP synthase subunit a?

Assessing the functional activity of recombinant S. amazonensis ATP synthase subunit a presents unique challenges because the a-subunit alone does not possess enzymatic activity but rather functions as part of the larger ATP synthase complex. Several complementary approaches can be employed:

Reconstitution Assays:
The gold standard for functional assessment involves reconstituting the purified subunit a with other ATP synthase components to form a functional complex. This can be achieved by co-expression with other subunits or by combining individually purified subunits in vitro. The reconstituted complex can then be incorporated into liposomes to create a system capable of generating or maintaining a proton gradient.

Proton Translocation Measurements:
Since the a-subunit forms part of the proton channel, proton translocation efficiency can be measured using pH-sensitive fluorescent dyes or proton flux assays. These measurements can be performed in reconstituted proteoliposomes under varying conditions to assess the contribution of the a-subunit to proton movement.

ATP Synthesis/Hydrolysis Assays:
In a fully reconstituted system, ATP synthesis can be measured directly by quantifying ATP production under conditions that generate a proton motive force. Alternatively, ATP hydrolysis (the reverse reaction) can be measured using established biochemical methods, including colorimetric assays that detect inorganic phosphate release. The efficiency of these processes provides insights into the functionality of the ATP synthase complex containing the recombinant a-subunit.

Structural Integrity Assessment:
Circular dichroism (CD) spectroscopy can be used to evaluate the secondary structure of the recombinant protein, providing information about proper folding. Similarly, fluorescence spectroscopy can assess tertiary structure by monitoring the environment of intrinsic fluorophores within the protein.

Data from S. oneidensis studies suggest that functional ATP synthase complexes show specific ATP utilization patterns, with a growth rate-dependent ATP requirement (GAR) of approximately 220.22 mmol ATP/g AFDW and a non-growth rate dependent ATP requirement (NGAR) of 1.03 mmol ATP/(g AFDW×h) . Similar parameters could be established for S. amazonensis to provide a benchmark for functional assessment.

What role does ATP synthase play in the unique metabolic capabilities of Shewanella species?

Shewanella species, including S. amazonensis, possess remarkable metabolic versatility, particularly their ability to use diverse terminal electron acceptors in anaerobic respiration. ATP synthase plays a critical role in harnessing the energy generated through these diverse respiratory pathways:

Respiratory Flexibility and ATP Production:
Shewanella's ability to utilize various electron acceptors (including oxygen, nitrate, fumarate, metal oxides like Fe(III) and Mn(IV), and even electrodes in microbial fuel cells) requires a flexible energy conservation system. The ATP synthase complex functions as the final component in these diverse respiratory chains, capturing energy from the proton gradient established by electron transport processes regardless of the terminal electron acceptor.

Research on S. oneidensis MR-1 has shown that the ATP requirements for growth and maintenance differ significantly based on respiratory conditions. The growth-associated ATP requirement (GAR) of 220.22 mmol ATP/g AFDW is notably higher than in many other microorganisms, suggesting that Shewanella species have evolved unique energy management strategies to support their metabolic versatility .

Adaptation to Environmental Fluctuations:
In environments with fluctuating oxygen levels or redox conditions, Shewanella species must rapidly adapt their energy generation systems. The ATP synthase complex, including the a-subunit, may have evolved specific features that optimize its function under these varying conditions. The amino acid sequence of the a-subunit shows characteristic patterns that may contribute to this adaptability.

Understanding these aspects of ATP synthase function in Shewanella provides insights not only into bacterial bioenergetics but also into potential biotechnological applications, such as bioremediation and microbial fuel cells, where these organisms' metabolic capabilities are being harnessed.

How can site-directed mutagenesis be applied to study critical residues in S. amazonensis ATP synthase subunit a?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in S. amazonensis ATP synthase subunit a. By systematically altering specific amino acid residues, researchers can gain valuable insights into the protein's mechanism:

Target Residue Selection:
Based on sequence analysis and comparison with other ATP synthase a-subunits, several categories of residues are particularly valuable targets for mutagenesis:

  • Conserved acidic residues (Asp, Glu) within transmembrane regions, which often participate directly in proton translocation

  • Residues at the interface with the c-ring, which are critical for the rotational mechanism

  • Highly conserved residues across bacterial species, suggesting functional importance

  • Residues unique to Shewanella, which may contribute to species-specific adaptations

Mutagenesis Strategy:
For transmembrane proteins like ATP synthase subunit a, a comprehensive mutagenesis approach typically includes:

  • Conservative substitutions (e.g., Asp to Glu) to preserve charge while altering side chain structure

  • Charge reversals (e.g., Asp to Lys) to assess the importance of electrostatic interactions

  • Alanine scanning of selected regions to identify essential side chains

  • Introduction of cysteine residues for accessibility studies and crosslinking experiments

Functional Assessment:
The impact of mutations can be evaluated using the functional assays described earlier. Particularly informative are measurements of proton translocation efficiency and ATP synthesis/hydrolysis rates in reconstituted systems. Evidence from studies with other ATP synthases indicates that mutations in critical residues of the a-subunit can completely abolish enzymatic activity, similar to observations from aspartic proteinase studies in Shewanella where mutation of catalytic Asp residues resulted in complete loss of enzymatic activity .

Structural Insights:
When combined with structural techniques such as cryogenic electron microscopy (cryo-EM) or cross-linking mass spectrometry, mutagenesis data can provide insights into the three-dimensional arrangement of the a-subunit within the ATP synthase complex. This is particularly valuable given the challenges associated with obtaining high-resolution structures of membrane protein complexes.

This mutagenesis approach has proven highly effective in studying ATP synthases from other organisms and would be equally applicable to investigating the unique features of the S. amazonensis enzyme, potentially revealing adaptations that contribute to this bacterium's ecological fitness.

What experimental approaches can be used to study the assembly of ATP synthase complexes containing recombinant S. amazonensis subunit a?

Understanding the assembly process of ATP synthase complexes containing recombinant S. amazonensis subunit a is crucial for both basic research and potential biotechnological applications. Several experimental approaches can effectively investigate this process:

Co-expression Systems:
Developing co-expression systems where multiple ATP synthase subunits are simultaneously produced allows for monitoring the assembly process in vivo. This approach can utilize dual or multi-vector systems in E. coli, with each vector containing different ATP synthase components. By incorporating different affinity tags on various subunits, researchers can purify partially assembled complexes and track the assembly pathway.

Assembly Kinetics Analysis:
Pulse-chase experiments combined with immunoprecipitation can track the incorporation of newly synthesized subunit a into the ATP synthase complex over time. This approach provides insights into the assembly sequence and rate-limiting steps. Additionally, time-resolved crosslinking can capture transient interactions during the assembly process.

Interaction Partner Identification:
For identifying proteins that assist in the assembly of ATP synthase complexes, techniques such as proximity labeling (BioID or APEX) can be employed. By fusing these enzymes to subunit a, researchers can identify proteins that come into close proximity during the assembly process. This approach might reveal specific chaperones or assembly factors that facilitate the incorporation of this hydrophobic subunit into the complex.

Structural Analysis of Assembly Intermediates:
Cryo-electron microscopy (cryo-EM) and single-particle analysis are particularly powerful for capturing various assembly states of large macromolecular complexes like ATP synthase. By analyzing samples at different time points during assembly, structural snapshots of the process can be obtained. This approach has successfully elucidated assembly pathways for other membrane protein complexes and could be applied to S. amazonensis ATP synthase.

Reconstitution Experiments:
In vitro reconstitution experiments starting with purified individual subunits allow for a controlled evaluation of assembly requirements. By systematically varying conditions (pH, ionic strength, lipid composition) and monitoring complex formation, researchers can identify factors that influence assembly efficiency. This approach is particularly valuable for understanding the specific requirements for incorporating the hydrophobic a-subunit into the complex.

These experimental approaches provide complementary information about the assembly process, potentially revealing unique features of ATP synthase assembly in Shewanella species that contribute to their remarkable metabolic flexibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.