Recombinant Shewanella amazonensis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; Sama_0925; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Target Names
lspA
Target Protein Sequence
MQLNWKESGLRWYWVVVVVFLADQLSKQWVLANFDLYESVKLLPFFNFTYVRNYGAAFSF LHDAGGWQRWLFTAVAVGFSVLLTIWLRKQPANMVRLNLAYTLVIGGALGNLIDRLQHGF VVDFLDFYWNTAHYPAFNIADAAIFIGAVLIIIDSFKASSSDDKAIKE
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the conformational dynamics of LspA affect its function and substrate binding?

The functional activity of LspA depends significantly on its conformational dynamics, which occur on the nanosecond timescale. Research using molecular dynamics simulations and electron paramagnetic resonance has revealed that LspA exhibits remarkable flexibility, particularly in its periplasmic helix (PH) .

In the apo (unbound) state, LspA predominantly assumes a closed conformation where the PH occludes the charged active site from the hydrophobic membrane environment. This conformation fluctuates between:

  • A most closed state (dominant): The β-cradle and PH are only 6.2 Å apart, completely occluding the charged and polar active site residues.

  • An intermediate state: Partially exposes the active site.

  • An open conformation (rare): Forms a trigonal cavity that can accommodate lipoprotein substrate binding .

This conformational flexibility explains how LspA accommodates and processes various lipoprotein substrates. When antibiotic inhibitors like globomycin bind, they stabilize an intermediate conformation that prevents both substrate binding and signal peptide cleavage. This structural plasticity makes LspA an excellent target for antibiotic development since it is essential in Gram-negative bacteria and important for virulence in Gram-positive bacteria .

What are the optimal storage and handling conditions for recombinant Shewanella amazonensis LspA?

For optimal preservation of recombinant S. amazonensis LspA activity, the following storage and handling protocols are recommended:

Storage ConditionRecommendation
Short-term storageStore at -20°C
Long-term storageStore at -20°C or -80°C
Working aliquotsStore at 4°C for up to one week
Buffer conditionsTris-based buffer with 50% glycerol
Freeze-thaw cyclesAvoid repeated freezing and thawing

When preparing the protein for experiments, it is advisable to make small aliquots to minimize freeze-thaw cycles, which can significantly reduce enzyme activity. The protein is typically provided in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein .

For reconstitution of lyophilized protein, it is recommended to briefly centrifuge the vial before opening, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% is advised for long-term storage .

How can I assess the enzymatic activity of recombinant Shewanella amazonensis LspA in laboratory experiments?

The enzymatic activity of recombinant S. amazonensis LspA can be assessed using several methodological approaches:

Gel-shift assay:

This coupled assay involves monitoring the cleavage of a prolipoprotein substrate. The reaction typically includes:

  • 12 µM pre-prolipoprotein substrate

  • 250 µM phospholipid (such as DOPG)

  • 1.2 µM Lgt (to generate the LspA substrate prolipoprotein)

  • 0.5 µM LspA

  • Buffer conditions: 50 mM Tris/HCl pH 7.5, 150 mM NaCl, 1 mM DTT

Samples are removed at timed intervals, and the reaction is stopped with SDS loading buffer. The cleavage of the signal peptide results in a mobility shift that can be visualized on SDS-PAGE .

FRET-based assay:

Using a fluorescence resonance energy transfer (FRET) lipopeptide substrate allows for real-time monitoring of enzymatic activity. This method can provide kinetic parameters such as Km and Vmax. Optimization of enzyme concentration, substrate concentration, and buffer conditions is crucial for accurate measurements .

Inhibition assays:

LspA activity can be assessed by measuring its inhibition with known inhibitors like globomycin. IC50 values can be determined by setting up dose-response assays with varying inhibitor concentrations .

When comparing with other LspA orthologs, it's important to note that kinetic parameters may vary significantly. For example, S. amazonensis LspA might exhibit different Km and Vmax values compared to other bacterial LspA enzymes such as those from P. aeruginosa .

What structural features distinguish bacterial aspartyl proteases like LspA from their eukaryotic counterparts?

Bacterial aspartyl proteases like Shewanella amazonensis LspA possess distinct structural features that differentiate them from eukaryotic pepsin-like aspartyl proteinases:

Key distinguishing features:

  • Membrane association: LspA is an integral membrane protein with multiple transmembrane domains, whereas eukaryotic pepsin-like proteases are typically soluble enzymes .

  • Active site architecture: While both enzyme types utilize catalytic aspartate residues, LspA's active site is formed between transmembrane helices with the catalytic dyad (Asp-Thr-Gly motif) positioned to cleave substrates within the membrane environment .

  • Conformational dynamics: LspA exhibits significant flexibility in its periplasmic helix, which fluctuates on the nanosecond timescale. This allows for accommodation of various lipoprotein substrates and is critical to its function .

  • Substrate specificity: LspA specifically cleaves prolipoproteins after they have been modified with a diacylglyceryl moiety by Lgt (lipoprotein diacylglyceryl transferase), representing a unique substrate specificity not found in eukaryotic proteases .

  • Inhibitor sensitivity: While both enzyme types are inhibited by pepstatin, bacterial LspA is uniquely sensitive to specific antibiotics like globomycin and myxovirescin, which bind to the enzyme through different conformational states of the periplasmic helix .

The identification of active pepsin-like aspartic proteinases in bacteria like Shewanella amazonensis (termed shewasin A) changed the long-held view that these enzymes were confined to eukaryotes. Shewasin A exhibits characteristics similar to eukaryotic pepsin-like proteases including maximal activity at acidic pH and inhibition by pepstatin, but maintains distinctive bacterial structural features .

How does Shewanella amazonensis LspA contribute to bacterial survival and virulence?

Shewanella amazonensis LspA plays a critical role in bacterial survival and potential virulence through several mechanisms:

Lipoprotein processing:

LspA is essential for processing prolipoproteins, which constitute approximately 2-3% of bacterial proteomes. By cleaving the signal peptide from lipid-modified prolipoproteins, LspA ensures proper localization and functioning of lipoproteins in the cell envelope .

Cell envelope integrity:

Properly processed lipoproteins are crucial for maintaining the structural integrity of the bacterial cell envelope. In Gram-negative bacteria like S. amazonensis, this is particularly important for the integrity of both inner and outer membranes .

Environmental adaptation:

S. amazonensis strain SB2B, isolated from the Amazon River delta, shows enhanced metabolic capabilities compared to other Shewanella species. It can utilize 60 different carbon compounds, reflecting its adaptation to nutrient-rich environments. The proper processing of lipoproteins by LspA is likely crucial for these metabolic functions .

What methods are used to express and purify recombinant Shewanella amazonensis LspA for structural and functional studies?

For successful expression and purification of recombinant Shewanella amazonensis LspA, the following methodological approach is recommended:

Expression protocol:

  • Transform the recombinant plasmid into chemically competent E. coli cells

  • Grow cells in TB media supplemented with appropriate antibiotic (e.g., 50 μg/mL kanamycin)

  • Grow at 37°C to an OD600 of 0.5-0.6

  • Induce expression with 1 mM IPTG

  • Continue growth at 30°C and 180 rpm for 18 hours

  • Harvest cells by centrifugation at 6000 × g for 15 min at 4°C

Purification strategy:

  • Cell lysis: Mechanical disruption or detergent-based methods

  • Membrane protein extraction: Solubilization using detergents like LMNG (lauryl maltose neopentyl glycol) or DDM (n-dodecyl-β-D-maltoside)

  • Affinity chromatography: Ni-NTA purification using the His-tag

  • Size exclusion chromatography: To achieve higher purity

  • Optional tag removal: If TEV cleavage site is included

Quality control:

  • SDS-PAGE to assess purity (>90% purity is typically achievable)

  • Western blot analysis to confirm identity

  • Activity assays using gel-shift or FRET-based methods to confirm functionality

For structural studies requiring highly pure protein, additional purification steps may be necessary, and detergent screening is often performed to identify conditions that maintain protein stability and activity .

How do globomycin and other antibiotics inhibit LspA, and what implications does this have for drug development?

Globomycin and other antibiotics like myxovirescin inhibit LspA through unique mechanisms that have important implications for antibiotic drug development:

Inhibition mechanism:

  • Globomycin binding: Globomycin acts as a non-cleavable tetrahedral intermediate analog, binding to LspA's active site. It approaches from one side of the substrate-binding pocket and is secured in place by the conserved Trp57 residue, which extends from a half-turn helix in the enzyme's periplasmic loop .

  • Myxovirescin binding: Despite having a different molecular structure from globomycin, myxovirescin inhibits LspA in an identical way as a non-cleavable tetrahedral intermediate analog. It approaches from the opposite side of the substrate-binding pocket, and the enzyme's periplasmic loop unfolds to allow Trp57 to contact the macrocycle .

  • Structural convergence: Remarkably, these two structurally distinct antibiotics superpose along nineteen contiguous atoms that interact similarly with LspA. This 19-atom motif recapitulates part of the substrate lipoprotein in its proposed binding mode .

  • Conformational effects: Both antibiotics stabilize an intermediate conformation of LspA that prevents both substrate binding and signal peptide cleavage .

Implications for drug development:

  • Resistance barrier: LspA is an excellent target for antibiotic development because:

    • It is essential in Gram-negative bacteria

    • It is important for virulence in Gram-positive bacteria

    • It has no mammalian equivalents

    • The extensive conservation of active site residues means resistance mutations would likely interfere with substrate binding and enzyme function

  • Blueprint for drug design: The 19-atom motif shared by globomycin and myxovirescin provides a valuable template for developing new antibiotics. Incorporating this motif into scaffolds with suitable pharmacokinetic properties could enable the development of effective antibiotics with built-in resistance hardiness .

  • Conformational targeting: Understanding the conformational dynamics of LspA enables the design of inhibitors that stabilize specific non-functional conformations of the enzyme .

The hybrid experimental designs using molecular dynamics and electron paramagnetic resonance have facilitated identification of protein conformations not observed in crystal structures, which will aid in future therapeutic development .

What are the specific challenges in working with membrane enzymes like LspA compared to soluble proteins?

Working with membrane enzymes like Shewanella amazonensis LspA presents several unique challenges that require specialized approaches:

Experimental challenges and solutions:

ChallengeSolution
Low expression yieldsUse specialized expression strains (C43, C41), optimize growth conditions, and consider fusion tags to enhance expression
Protein extractionSelect appropriate detergents for solubilization; commonly used detergents include LMNG, DDM, and FC12 for LspA studies
Maintaining native conformationUtilize lipid reconstitution or nanodiscs to provide a membrane-like environment
Assay developmentDesign coupled assays that account for the membrane environment; for LspA, this often involves reconstituting the enzyme with lipids and using fluorescent or gel-based detection methods
Structural studiesEmploy complementary approaches such as X-ray crystallography, cryo-EM, and spectroscopic methods like EPR to capture conformational dynamics

LspA-specific methodological considerations:

  • Activity assessment: When measuring LspA activity, it's essential to include appropriate phospholipids in the assay mixture (e.g., DOPG at 250 µM). The enzyme requires a lipid environment for proper folding and function .

  • Conformational analysis: To study the conformational dynamics of LspA, researchers have successfully employed:

    • Continuous-wave (CW) EPR experiments on singly labeled LspA proteins in detergent micelles

    • Molecular dynamics simulations to map conformational states

    • DEER (Double Electron-Electron Resonance) EPR to detect distance changes between labeled sites

  • Inhibitor studies: When studying inhibitors like globomycin, special attention must be paid to solvent effects. For instance, DMSO (often used to solubilize inhibitors) can significantly impact CW EPR spectra, necessitating controlled solvent removal before measurements .

  • Buffer optimization: The choice of buffer, pH, salt concentration, and additives significantly impacts LspA stability and activity. Typical buffer conditions include 50 mM Tris/HCl pH 7.5, 150 mM NaCl, 1 mM DTT, and 0.02% (w/v) detergent .

Understanding these challenges and implementing appropriate methodological solutions is crucial for successful experimental work with membrane enzymes like LspA.

How does the ecological niche of Shewanella amazonensis influence the properties of its LspA enzyme?

The ecological niche of Shewanella amazonensis significantly influences the properties and function of its LspA enzyme, reflecting evolutionary adaptations to its specific environment:

Ecological context and adaptive features:

  • Habitat specialization: Shewanella amazonensis strain SB2B was isolated from the Amazon River delta, a nutrient-rich aquatic environment with unique characteristics .

  • Metabolic versatility: Comparative phenotypic analysis has shown that S. amazonensis is capable of utilizing 60 different carbon compounds, which is significantly more than other Shewanella species from different environments. For example, Shewanella sp. strain W3-18-1, isolated from deep marine sediment, could utilize only 25 carbon compounds .

  • Substrate processing capacity: The enhanced metabolic capabilities of S. amazonensis correlate with its LspA's need to process a wider variety of lipoproteins involved in nutrient acquisition and environmental sensing. This is reflected in the enzyme's conformational flexibility, which allows it to accommodate various substrates .

  • Thermal adaptation: The Amazon River delta experiences temperature fluctuations, and the LspA enzyme from S. amazonensis likely possesses stability characteristics adapted to these conditions. This may explain why the recombinant protein exhibits optimal storage at -20°C to -80°C but maintains activity for up to a week at 4°C .

Evolutionary implications:

  • Functional conservation with structural adaptation: While the core catalytic function of LspA is conserved across bacterial species (reflecting its essential role), specific structural adaptations in S. amazonensis LspA likely reflect its ecological niche requirements .

  • Phenotype-genotype correlation: The comparative high-throughput phenotype analysis of different Shewanella strains provides insights into how ecological specialization correlates with genetic adaptations, including those affecting the lipoprotein processing pathway .

  • Adaptive substrate range: The flexibility of the periplasmic helix in S. amazonensis LspA allows it to process a diverse range of lipoproteins, which may be particularly important in a nutrient-rich but fluctuating environment like a river delta .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.