Recombinant Shewanella amazonensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
mtgA; Sama_0740; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Target Names
mtgA
Target Protein Sequence
MSEKDLGGGKKAGFIARTWRGFWRWSARLLVAFLILSLVLVATVSVINPPTWAWRIDRAL FPPKEDIQVRHQWVPLDKIAAHMQLAVIAAEDQRFTLHNGVDFAAIKTAIADRDPGEPLR GASTLTQQTAKNLFLWSSRSFVRKGLEAWFALLLDTLSGKRRTLELYLNIVEFGPGIYGV EAASRYYFNKGAGKLSTREAALLAALLPNPWSYRINPPTAYMNRRADWIARQMRQLGMAT LKDLD
Uniprot No.

Target Background

Function

Recombinant Shewanella amazonensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes the elongation of glycan chains from lipid-linked precursors.

Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Recombinant Shewanella amazonensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)?

Recombinant Shewanella amazonensis Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a bacterial enzyme responsible for catalyzing glycan chain elongation in bacterial cell wall synthesis. This recombinant protein is derived from Shewanella amazonensis strain ATCC BAA-1098 / SB2B, with UniProt accession number A1S3J2 . The enzyme is characterized as a monofunctional transglycosylase (EC 2.4.2.-) that specifically participates in peptidoglycan assembly without the transpeptidase activity found in bifunctional penicillin-binding proteins (PBPs). The full-length protein consists of 245 amino acid residues and plays a crucial role in bacterial cell wall biosynthesis.

What is the biological function of mtgA in bacterial cell wall synthesis?

The monofunctional peptidoglycan glycosyltransferase (mtgA) catalyzes glycan chain elongation of the bacterial cell wall, a critical process for bacterial survival and growth . Unlike bifunctional class A Penicillin-Binding Proteins (PBPs) that possess both transglycosylase and transpeptidase activities, mtgA specifically performs the glycosyltransferase function, polymerizing the lipid II substrate into peptidoglycan strands. Research on E. coli mtgA demonstrates that it contributes to peptidoglycan assembly during cell division, particularly at the septal region. The enzyme plays a complementary role to class A PBPs, potentially providing redundancy in the peptidoglycan synthesis machinery to ensure cell wall integrity even when some components are compromised .

How does mtgA localize within bacterial cells during division?

Studies on E. coli mtgA demonstrate that it localizes at the division site (septum) in cells deficient in PBP1b and expressing a thermosensitive PBP1a . This localization pattern suggests that mtgA serves as a backup mechanism for septal peptidoglycan synthesis when the primary class A PBPs are compromised. When GFP-tagged mtgA was examined in E. coli strain EJ801 (ponA(ts) ponB), the protein showed clear localization at midcells. Interestingly, when the same strain was transformed with a plasmid expressing functional PBP1b, the septal localization of mtgA was no longer observed . This finding indicates that mtgA's recruitment to the divisome may be regulated by the availability and functionality of class A PBPs, suggesting a compensatory mechanism for peptidoglycan synthesis.

What are the optimal conditions for measuring mtgA glycosyltransferase activity in vitro?

Based on experimental procedures with E. coli mtgA, the optimal conditions for measuring glycosyltransferase activity in vitro include:

Reaction Mixture Components:

  • Radiolabeled lipid II substrate (e.g., [14C]GlcNAc-labeled lipid II, 9,180 dpm/nmol)

  • 15% dimethyl sulfoxide

  • 10% octanol

  • 50 mM HEPES buffer (pH 7.0)

  • 0.5% decyl-polyethylene glycol

  • 10 mM CaCl₂

The glycosyltransferase activity can be measured by the incorporation of radiolabeled substrate into polymerized peptidoglycan material. In studies with GFP-MtgA fusion protein, a 2.4-fold increase in peptidoglycan polymerization was observed compared to control (26% versus 11% of lipid II utilized) . The polymerized material should be completely digestible by lysozyme, confirming its identity as peptidoglycan. This assay provides a quantitative measurement of mtgA's glycosyltransferase activity.

How can researchers verify protein-protein interactions involving mtgA?

Researchers can use bacterial two-hybrid systems to verify protein-protein interactions involving mtgA. In published studies, this approach successfully demonstrated interactions between mtgA and several divisome proteins in E. coli . The method involves:

  • Creating fusion constructs of mtgA and potential interaction partners with complementary fragments of adenylate cyclase (CyaA).

  • Co-expressing these constructs in a reporter strain (e.g., DHM1).

  • Measuring β-galactosidase activity as an indicator of protein-protein interaction.

This method has revealed specific interactions between mtgA and three key divisome components: PBP3, FtsW, and FtsN . The transmembrane segment of PBP3 was found to be essential for this interaction. Additionally, mtgA was shown to interact with itself, suggesting potential dimerization or oligomerization during function. The quantitative nature of the β-galactosidase assay allows for comparative assessment of interaction strengths between different protein pairs.

How does mtgA interact with other cell division proteins in the divisome?

Experimental evidence from bacterial two-hybrid studies demonstrates that mtgA interacts specifically with three key components of the bacterial divisome: PBP3 (a class B penicillin-binding protein), FtsW (a lipid II flippase), and FtsN (a late divisome protein) . These interactions suggest that mtgA is integrated into the divisome complex during cell division, allowing coordinated peptidoglycan synthesis at the septum.

The interaction with PBP3 is particularly noteworthy as it requires the transmembrane segment of PBP3, suggesting a specific membrane-proximal association. This finding indicates that mtgA may collaborate with PBP3 to synthesize the peptidoglycan of new poles during cell division . Additionally, the interaction with FtsN is significant because FtsN has been shown to stimulate the peptidoglycan synthesis activities of PBP1b and might play a coordinating role for peptidoglycan synthases during cell division.

What is the relationship between mtgA and class A Penicillin-Binding Proteins (PBPs)?

The relationship between mtgA and class A PBPs appears to be compensatory and possibly competitive for localization at the division site. In E. coli, mtgA localizes at the division site specifically when the major class A PBPs are absent or compromised (cells deficient in PBP1b and expressing a thermosensitive PBP1a) . When functional PBP1b was reintroduced into these cells, mtgA no longer localized at midcells, suggesting that class A PBPs may outcompete mtgA for divisome recruitment under normal conditions.

This compensatory relationship indicates that mtgA may serve as a backup system for peptidoglycan glycosyltransferase activity when the primary class A PBPs are not fully functional. The ability of mtgA to interact with divisome components (PBP3, FtsW, and FtsN) that also interact with class A PBPs further suggests overlapping functional roles in the peptidoglycan synthesis machinery.

What are the optimal storage conditions for recombinant mtgA?

For optimal preservation of recombinant Shewanella amazonensis mtgA activity, the following storage conditions are recommended:

  • Short-term storage (up to one week): Store working aliquots at 4°C .

  • Standard storage: Store at -20°C in a Tris-based buffer containing 50% glycerol optimized for protein stability .

  • Extended storage: Conserve at -20°C or -80°C for maximum preservation of activity .

Important handling notes:

  • Repeated freezing and thawing is not recommended as it may lead to protein denaturation and loss of activity .

  • Prepare small working aliquots to minimize freeze-thaw cycles.

  • The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which helps maintain protein stability during storage .

What considerations are important when obtaining mtgA through Material Transfer Agreements?

When obtaining recombinant mtgA or similar research materials through Material Transfer Agreements (MTAs), researchers should consider several key aspects:

  • Intellectual property implications: MTAs define terms and conditions for material exchange, including ownership rights to research results obtained using the material .

  • Potential restrictions: Some MTA terms may restrict academic freedom by limiting publication rights or imposing confidentiality requirements that could impede research dissemination .

  • "Reach-through rights": Be aware of provisions that might grant the provider rights to discoveries made using the material, even if those discoveries don't directly involve the transferred material .

  • Standardization options: Consider using standardized MTA templates (such as the Uniform Biological Material Transfer Agreement) when possible to expedite the transfer process .

  • Institutional approval: Ensure that the appropriate institutional authority reviews and signs the MTA, as individual researchers may not have the authority to commit their institution to legal agreements .

How can researchers effectively study mtgA's role in peptidoglycan synthesis?

To effectively study mtgA's role in peptidoglycan synthesis, researchers can employ multiple complementary approaches:

  • Fluorescent protein fusions: Creating GFP-mtgA fusion constructs allows visualization of the protein's localization in live cells under various conditions. This approach revealed mtgA's septal localization in E. coli strains with compromised class A PBPs .

  • In vitro glycosyltransferase assays: Using radiolabeled lipid II substrate to measure the glycan chain polymerization activity of purified mtgA. The products can be verified by lysozyme digestion, which should completely degrade the polymerized material .

  • Protein-protein interaction studies: Implementing bacterial two-hybrid systems to identify and quantify interactions between mtgA and divisome components. This approach has successfully demonstrated mtgA's interactions with PBP3, FtsW, and FtsN .

  • Genetic complementation experiments: Examining whether expression of mtgA can compensate for deficiencies in other peptidoglycan synthases by restoring cell growth or morphology in mutant strains.

  • Conditional expression systems: Using temperature-sensitive strains or inducible promoters to control the expression of mtgA and other peptidoglycan synthases to study their functional redundancy and cooperation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.