Recombinant Shewanella amazonensis Probable intracellular septation protein A (Sama_2137)

What is Sama_2137 and what organism does it originate from?

Sama_2137 is a probable intracellular septation protein A derived from the bacterium Shewanella amazonensis, specifically strain ATCC BAA-1098 / SB2B. The protein is classified under the UniProt accession number A1S7I6 and is also known by the alternative gene name yciB. The protein is characterized as an inner membrane-spanning protein that plays a role in cellular septation processes during bacterial cell division. Shewanella amazonensis is a gram-negative bacterium that has gained research interest due to its diverse metabolic capabilities and potential biotechnological applications. The bacterium was originally isolated from sediments in the Amazon River delta, hence its species name, and has adapted to thrive in various environmental conditions.

What is the amino acid sequence and structural characteristics of Sama_2137?

The full amino acid sequence of Sama_2137 consists of 181 amino acids with the following sequence: MKQLLDFLPLLVFFAVYKFFDIYAATGALIVATLIQLIATYALYKKIEKMHLITFALVASFGTATLIFHDDAFIKWKVTIVYALFAIALIAAGQFLGKPILKMLGQEMPVDDKIWARLTYWYVLFFVACGLINIYVAFSLSQETWVNFKVFGLTAATLVNTLLTVVYLFKHLPEDKKKELK. The protein contains a transmembrane domain consistent with its function as an inner membrane-spanning protein. The structural analysis suggests that Sama_2137 adopts a conformation that facilitates its integration into the bacterial cell membrane, with hydrophobic regions embedded within the lipid bilayer and hydrophilic regions exposed to the cytoplasm or periplasmic space. Bioinformatic analyses indicate that the protein contains specific motifs characteristic of proteins involved in cell division and septation processes. The tertiary structure likely includes alpha-helical regions that span the membrane multiple times.

What expression systems are most effective for producing recombinant Sama_2137?

Multiple expression systems have been successfully employed for the production of recombinant Sama_2137, each with distinct advantages for different research applications. Escherichia coli represents the most commonly utilized expression system due to its rapid growth rate and well-established genetic manipulation tools. The protein can be expressed in E. coli with various tags to facilitate purification, including His-tags, GST-tags, or Avi-tags for biotinylation. For researchers requiring post-translational modifications or improved solubility, yeast expression systems (Saccharomyces cerevisiae or Pichia pastoris) offer advantages for certain experimental setups. More complex expression systems including baculovirus-infected insect cells and mammalian cell cultures have also been used successfully when proper protein folding and modification are critical to experimental outcomes. The selection of an expression system should be guided by the specific research questions being addressed, with consideration given to the required protein yield, downstream applications, and the importance of native-like structure and function.

The table below summarizes the key characteristics of different expression systems for recombinant Sama_2137:

What purification strategies yield highest purity and activity of recombinant Sama_2137?

Optimal purification of recombinant Sama_2137 requires a multi-step approach to achieve high purity while maintaining structural integrity and biological activity. The initial purification step typically involves affinity chromatography, leveraging the fusion tags incorporated during recombinant expression. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins provides effective initial capture of the target protein. Following affinity purification, ion exchange chromatography serves as an effective secondary purification step, with cation or anion exchange selected based on the theoretical isoelectric point of the Sama_2137 construct. Size exclusion chromatography represents an essential final polishing step to remove aggregates and ensure a homogeneous protein preparation with >85% purity as verified by SDS-PAGE analysis. Throughout the purification process, buffer optimization is critical, with the inclusion of 50% glycerol in storage buffers recommended to maintain protein stability during long-term storage. Additionally, the incorporation of appropriate protease inhibitors during the early stages of purification can prevent degradation and improve final yield and quality.

How should recombinant Sama_2137 be stored to maintain stability and activity?

Proper storage of recombinant Sama_2137 is essential for maintaining protein stability and preserving its biological activity for experimental use. The protein is typically provided as a lyophilized powder, which should be briefly centrifuged before opening to ensure all material is collected at the bottom of the vial. Reconstitution should be performed using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. For optimal stability, the addition of glycerol to a final concentration of 50% is strongly recommended, although this percentage can be adjusted between 5-50% depending on downstream applications. Following reconstitution, the protein solution should be aliquoted into small volumes to minimize freeze-thaw cycles, which can significantly compromise protein integrity. Long-term storage should be conducted at -20°C or -80°C, with the latter preferred for extended storage periods exceeding six months. For short-term use (up to one week), working aliquots can be maintained at 4°C. Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation, aggregation, and loss of biological activity. Researchers should validate protein stability after storage using activity assays relevant to their specific experimental objectives.

What methodologies are most effective for studying the membrane localization of Sama_2137?

Investigation of Sama_2137 membrane localization requires a multi-faceted approach combining biochemical fractionation with advanced microscopy techniques. Subcellular fractionation represents a foundational method, where bacterial cells expressing Sama_2137 are subjected to differential centrifugation to separate cytoplasmic, periplasmic, and membrane fractions, followed by Western blot analysis using anti-Sama_2137 antibodies to determine the protein's distribution. Fluorescence microscopy with GFP-tagged Sama_2137 provides valuable spatial information, allowing visualization of the protein's distribution pattern within living bacterial cells during various growth phases and cell division stages. For higher resolution analysis, immunogold electron microscopy can precisely localize Sama_2137 within the bacterial ultrastructure, particularly at septal regions during cell division. Additionally, protein topology can be determined using protease accessibility assays, where intact cells, spheroplasts, and membrane vesicles are treated with proteases, and the resulting Sama_2137 fragmentation pattern is analyzed to determine which portions are exposed to different cellular compartments. The combination of these complementary approaches provides a comprehensive understanding of Sama_2137's subcellular localization and membrane topology.

How can researchers investigate the role of Sama_2137 in bacterial cell division?

Investigating the role of Sama_2137 in bacterial cell division requires a comprehensive experimental strategy encompassing genetic manipulation, phenotypic characterization, and protein interaction studies. Gene knockout or knockdown approaches represent the primary method for functional analysis, where CRISPR-Cas9 or homologous recombination techniques can be employed to generate Sama_2137-deficient Shewanella amazonensis strains. The resulting mutants should be characterized through growth curve analysis, morphological examination using phase-contrast and electron microscopy, and fluorescent staining of nucleoids and septal rings to assess division defects. Complementation studies, where wild-type or mutant Sama_2137 is reintroduced into knockout strains, can confirm phenotype specificity and identify critical functional domains. Protein-protein interaction studies using bacterial two-hybrid systems, co-immunoprecipitation, or proximity labeling methods can identify binding partners within the cell division machinery. Time-lapse microscopy of fluorescently labeled Sama_2137 during the bacterial cell cycle provides dynamic information about protein localization during division. Together, these approaches can elucidate the specific contribution of Sama_2137 to the complex process of bacterial cell division and septum formation.

What analytical techniques can determine if Sama_2137 interacts with the Shewanella cell wall synthesis machinery?

Investigating potential interactions between Sama_2137 and the cell wall synthesis machinery requires a battery of complementary biochemical and biophysical techniques. Pull-down assays represent a foundational approach, where tagged Sama_2137 is used as bait to capture interacting proteins from bacterial lysates, followed by mass spectrometry identification of binding partners associated with peptidoglycan synthesis. Surface plasmon resonance (SPR) or bio-layer interferometry can provide quantitative binding kinetics between purified Sama_2137 and candidate interaction partners from the cell wall synthesis pathway. In vivo crosslinking experiments, utilizing membrane-permeable crosslinkers followed by immunoprecipitation and mass spectrometry, can capture transient interactions occurring within the native cellular environment. Bacterial two-hybrid or split-GFP complementation assays offer genetic approaches to verify specific protein-protein interactions. Functional reconstitution experiments, where purified Sama_2137 is added to in vitro peptidoglycan synthesis assays, can directly assess its impact on cell wall formation activity. Additionally, differential phenotypic analysis of peptidoglycan architecture in wild-type versus Sama_2137-deficient strains using advanced microscopy and biochemical analysis can provide evidence for functional relationships even in the absence of direct physical interactions.

How does Sama_2137 compare to other bacterial intracellular septation proteins in terms of structure and function?

Comparative analysis of Sama_2137 with other bacterial intracellular septation proteins reveals both conserved features and distinct characteristics that reflect evolutionary adaptation to specific cellular environments. Sequence alignment and phylogenetic analysis indicate that Sama_2137 belongs to the YciB family of membrane proteins, which are widely distributed across gram-negative bacteria but show considerable sequence divergence. Unlike the highly conserved FtsZ proteins that form the central division machinery, YciB-family proteins like Sama_2137 exhibit greater variability, suggesting accessory or species-specific roles in the division process. Structural predictions based on homology modeling suggest that Sama_2137 adopts a multi-pass transmembrane configuration similar to YciB proteins from E. coli and other gram-negative bacteria, though with unique extracellular loop regions that may confer substrate specificity or interaction partner selectivity. Functional complementation experiments, where Sama_2137 is expressed in YciB-deficient strains of other bacterial species, can reveal the degree of functional conservation across species boundaries. These comparative approaches illuminate the evolutionary trajectory of septation proteins and provide insights into both the core mechanisms of bacterial cell division and the specialized adaptations that have evolved in Shewanella amazonensis.

What advanced imaging techniques can visualize Sama_2137 dynamics during the bacterial cell cycle?

Advanced imaging techniques offer unprecedented insights into the dynamic behavior of Sama_2137 throughout the bacterial cell cycle. Super-resolution microscopy methods such as Structured Illumination Microscopy (SIM), Stimulated Emission Depletion (STED) microscopy, and Single-Molecule Localization Microscopy (SMLM) can visualize Sama_2137 distribution with resolution below the diffraction limit, revealing nanoscale organization patterns impossible to detect with conventional microscopy. For dynamic studies, Fluorescence Recovery After Photobleaching (FRAP) and single-particle tracking of fluorescently labeled Sama_2137 can measure protein mobility and exchange rates at different cellular locations throughout the division cycle. Correlative Light and Electron Microscopy (CLEM) combines the molecular specificity of fluorescence imaging with the ultrastructural context provided by electron microscopy, allowing researchers to precisely localize Sama_2137 relative to membrane structures and division sites. Live-cell imaging using microfluidic devices enables continuous observation of protein dynamics throughout multiple cell division cycles under controlled environmental conditions. Förster Resonance Energy Transfer (FRET) microscopy can detect direct molecular interactions between Sama_2137 and other division proteins in living cells. These advanced imaging approaches provide a multi-dimensional view of Sama_2137's spatial and temporal behavior during bacterial cell division processes.

How can structural biology approaches be applied to understand Sama_2137 function?

Structural biology approaches provide critical insights into Sama_2137 function by elucidating its three-dimensional architecture and molecular interaction interfaces. X-ray crystallography represents a gold-standard approach for high-resolution structure determination, though the membrane-embedded nature of Sama_2137 presents significant challenges for crystallization. Cryo-electron microscopy (cryo-EM) offers an alternative route to structural characterization, particularly suitable for membrane proteins that can be purified in detergent micelles or reconstituted into nanodiscs or liposomes. Nuclear Magnetic Resonance (NMR) spectroscopy, while typically limited to smaller proteins, can provide valuable information about flexible regions and dynamics of specific domains of Sama_2137. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map solvent-accessible regions and conformational changes upon ligand binding or protein-protein interactions. Molecular dynamics simulations, informed by experimental structural data, can model the dynamic behavior of Sama_2137 within a lipid bilayer environment and predict how mutations might affect its function. Site-directed mutagenesis of predicted functional residues, followed by activity assays and phenotypic analysis, provides experimental validation of structural predictions. Integration of these complementary structural approaches creates a comprehensive molecular understanding of how Sama_2137's architecture enables its biological function in bacterial cell division.

What are common challenges in expressing Sama_2137 and how can they be overcome?

Expression of Sama_2137 presents several technical challenges stemming from its nature as a membrane-integrated protein. Toxicity to host cells represents a common obstacle, as overexpression of membrane proteins can disrupt host cell envelope integrity and activate stress responses. This can be mitigated by employing tightly regulated inducible promoter systems, reducing induction temperature (16-20°C), and utilizing specialized E. coli strains designed for membrane protein expression (such as C41/C43(DE3) or Lemo21(DE3)). Protein misfolding and aggregation frequently occur due to the hydrophobic nature of membrane segments, which can be addressed by incorporating fusion partners that enhance solubility (such as MBP or SUMO tags) and optimizing detergent or lipid conditions during extraction and purification. Low expression yield is another persistent challenge that can be improved through codon optimization of the Sama_2137 gene for the expression host, screening multiple expression vector and host strain combinations, and implementing high cell-density fermentation protocols. Proteolytic degradation may occur if the expressed protein adopts non-native conformations, which can be reduced by adding protease inhibitors during purification and identifying and removing protease-susceptible sites through protein engineering. Systematic optimization of these parameters through small-scale expression trials is essential before proceeding to large-scale production.

How should researchers troubleshoot functional assays when working with Sama_2137?

Troubleshooting functional assays for Sama_2137 requires systematic analysis of multiple experimental parameters and careful control experiments. Protein quality represents the most fundamental consideration, as improperly folded or degraded protein can yield misleading results in functional studies. This can be addressed by implementing quality control steps including size exclusion chromatography to verify monodispersity, circular dichroism to confirm secondary structure, and thermal shift assays to assess protein stability under assay conditions. Assay buffer composition significantly impacts membrane protein function, necessitating optimization of pH, ionic strength, and divalent cation concentrations, with particular attention to detergent type and concentration for in vitro studies. Activity loss during storage is a common challenge that can be mitigated by adding stabilizing agents such as glycerol, testing cryoprotectant formulations, and preparing fresh protein samples for critical experiments. Non-specific binding to assay components can generate false positives, which can be controlled by including appropriate blocking agents and implementing stringent washing steps in binding assays. Cellular localization in heterologous expression systems may differ from native patterns, requiring verification through subcellular fractionation and immunolocalization studies. Establishing appropriate positive and negative controls is essential, including known functional mutants and related proteins with established activity profiles.

What experimental design considerations are critical when studying potential interaction partners of Sama_2137?

Designing robust experiments to identify and validate Sama_2137 interaction partners requires careful consideration of multiple technical factors to ensure biological relevance and minimize artifacts. Selection of appropriate experimental conditions is paramount, as interactions involving membrane proteins like Sama_2137 are highly dependent on the membrane environment. Studies should be conducted in conditions that maintain native-like membrane composition or utilize suitable membrane mimetics such as nanodiscs or liposomes rather than harsh detergents that may disrupt weak but functionally important interactions. Control for non-specific binding is essential, particularly for hydrophobic membrane proteins, requiring parallel experiments with unrelated membrane proteins of similar size and topology to distinguish specific from non-specific interactions. Validation across multiple techniques represents a crucial aspect of interaction studies, with orthogonal methods such as co-immunoprecipitation, proximity labeling, FRET, and split-reporter assays providing complementary evidence for physical associations. Quantitative analysis of binding affinities and kinetics should be performed using techniques like isothermal titration calorimetry or surface plasmon resonance to characterize the strength and dynamics of interactions. Functional validation of identified interactions through mutational analysis and phenotypic studies is necessary to establish biological significance beyond mere physical association. Additionally, consideration of the temporal and spatial regulation of interactions is critical, as many protein-protein interactions in bacterial cell division are transient and cell-cycle dependent.

How can Sama_2137 research contribute to understanding bacterial cell division mechanisms?

Research on Sama_2137 offers significant potential to advance our understanding of bacterial cell division mechanisms, particularly in gram-negative bacteria. Comparative genomic and functional studies of Sama_2137 across diverse bacterial species can illuminate the evolutionary conservation and divergence of septation mechanisms, revealing both core processes essential to all bacteria and specialized adaptations in different lineages. Investigation of the regulatory networks controlling Sama_2137 expression and activity can provide insights into how bacteria coordinate chromosome replication, cell growth, and division, potentially identifying novel regulatory pathways not previously recognized in model organisms. Structural analysis of Sama_2137 and its interactions with other division proteins may reveal new mechanistic principles for how membrane-embedded proteins participate in the complex process of bacterial cytokinesis. The identification of small molecule inhibitors targeting Sama_2137 could lead to novel antibacterial compounds with unique mechanisms of action, addressing the urgent need for new antibiotics in the face of increasing antimicrobial resistance. Integration of Sama_2137 research with systems biology approaches, including proteome-wide interaction mapping and metabolic modeling, can provide a holistic understanding of how septation proteins function within the broader cellular network. These diverse research directions collectively contribute to the fundamental goal of comprehensively understanding bacterial cell division, one of the most essential and complex processes in prokaryotic biology.

What potential biotechnological applications might emerge from Sama_2137 research?

Research on Sama_2137 holds promise for diverse biotechnological applications beyond fundamental scientific understanding. Antimicrobial development represents a primary application area, as proteins involved in bacterial cell division constitute attractive antibiotic targets due to their essential nature and absence in mammalian cells. High-throughput screening campaigns targeting Sama_2137 function could identify novel inhibitory compounds with potential development into antibiotics effective against multidrug-resistant pathogens. Protein engineering approaches could leverage the membrane-spanning properties of Sama_2137 to develop chimeric proteins for biotechnological applications, such as engineered membrane anchor domains for surface display of enzymes or binding proteins. Synthetic biology applications may emerge from understanding how Sama_2137 contributes to cellular architecture, potentially enabling the engineering of bacteria with altered cell shapes or division patterns for specialized industrial applications. Biosensor development represents another promising direction, where Sama_2137 or its derivatives could be incorporated into systems designed to detect specific environmental signals that trigger bacterial cell division. Additionally, fundamental insights into membrane protein folding and stability gained from Sama_2137 research may inform improved heterologous expression systems for other challenging membrane proteins of pharmaceutical and industrial importance. As research progresses, the unique properties of this bacterial septation protein will likely inspire innovative applications in both basic and applied biotechnology.

What are the most promising future research directions for understanding Sama_2137 function?

Future research on Sama_2137 should pursue several high-priority directions to comprehensively elucidate its function in bacterial physiology. Single-cell and time-resolved studies represent a particularly promising approach, employing microfluidics and advanced imaging to track Sama_2137 dynamics in individual bacteria through complete cell cycles, revealing how its localization and activity are coordinated with other division events. Integrative structural biology approaches combining cryo-electron tomography, molecular dynamics simulations, and in situ structural methods can determine how Sama_2137 is organized within the native divisome complex at the molecular level. Systems-level investigations applying transcriptomics, proteomics, and metabolomics to compare wild-type and Sama_2137-deficient strains can reveal broader physiological consequences of Sama_2137 dysfunction beyond direct effects on septation. Evolutionary studies examining Sama_2137 homologs across diverse bacterial phyla can illuminate how this protein family has adapted to different cellular architectures and division mechanisms throughout prokaryotic evolution. Mechanistic studies of protein-protein and protein-lipid interactions are essential to determine how Sama_2137 communicates with both the divisome machinery and the surrounding membrane environment during the division process. Development of chemical biology tools, including photo-crosslinking analogs and activity-based probes, will enable more precise characterization of Sama_2137's molecular interactions and conformational changes during its functional cycle. These multidisciplinary approaches will collectively advance our understanding of this bacterial septation protein from descriptive characterization to mechanistic insight.