Recombinant Shewanella amazonensis Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiB; Sama_3204; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-549
Protein Length
full length protein
Species
Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Target Names
ubiB
Target Protein Sequence
MTFASLRRGYQVIRTLLHYGLDDVLPPTLLPGYFKLLRLCLFWVRNRHKDKCGGERLKLA MQELGPVYIKFGQMLSTRRDLLSDEWAQELSMLQDRVPAFDSALAREAIEAELKAPIDSL FDDFDDTPLASASISQVHTATLKSNGQQVVLKVLRPNVEANIKADLELMLQVATWVNRLL GEGNRLRPVEVVEDYQNTILGELNLKLEALNATKLRNNFLDSDALYIPYVYEELCHPRLM VMERIDGIPVSDIEALNAQGTNLKLLAERGVELFFTQVFRDNFFHADMHPGNIFISREHP ENPFYIGLDCGIMGSLNEEDKRYLAENFLAFFNRDYHRIAQLYVESGWVSADTDILAFEQ AVKLVCEPMFNKPLNEISFGHVLLELFRTARRFDIVVQPQLVLLEKTLLYIEGLGRQLYP QLDLWQTAKPFLERWMAEQVGPKAIFKKVQTNLPFWSDKLPEFPELIYDNLKLGRKLLGS QQQMLDRYLKYQQKAHKSNFLLITSAVLLICGTILFAQTDTLWLASACLGSGALVWGAGW RSRPKNRKF
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UbiB and what is its functional role in ubiquinone biosynthesis?

UbiB is a protein required for the first monooxygenase step in Coenzyme Q (CoQ) biosynthesis. Specifically, it is involved in the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, which represents the fourth step in ubiquinone biosynthesis . UbiB belongs to a predicted protein kinase family of which the Saccharomyces cerevisiae ABC1 gene is the prototypic member .

Research on Escherichia coli has shown that yigR (now identified as ubiB) is homologous to the aarF gene in Providencia stuartii, and both are required for CoQ biosynthesis. Disruption mutant strains of both P. stuartii aarF and E. coli ubiB lack CoQ and accumulate octaprenylphenol, suggesting a conserved function in the ubiquinone biosynthetic pathway .

The UbiB protein in S. amazonensis is predicted to function similarly to its homologs in other bacterial species, playing a crucial role in electron transport chains and energy metabolism through ubiquinone production.

How is recombinant UbiB from S. amazonensis typically expressed and purified for research applications?

Recombinant Shewanella amazonensis UbiB protein can be produced using standard heterologous expression systems, typically in E. coli. The following methodology represents a general approach:

  • Expression vector design: The ubiB gene (corresponding to the 549 amino acid sequence) is cloned into an appropriate expression vector with an affinity tag (His-tag, GST, or similar) to facilitate purification.

  • Expression conditions: Due to UbiB being a membrane protein, expression optimization is critical:

    • Use E. coli strains specialized for membrane protein expression (such as C41(DE3) or C43(DE3))

    • Induce at lower temperatures (16-20°C) to promote proper folding

    • Add membrane-stabilizing agents to the culture medium

  • Purification protocol:

    • Cell lysis using detergent-containing buffers (typically containing 1-2% n-dodecyl-β-D-maltoside or similar)

    • Metal affinity chromatography (for His-tagged constructs)

    • Size exclusion chromatography for final purification

  • Storage conditions: The purified protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, with multiple freeze-thaw cycles not recommended .

When working with the recombinant protein, it's advisable to maintain small working aliquots at 4°C for up to one week to maintain protein integrity .

How does UbiB contribute to quinone metabolism and its relationship to bacterial adaptation?

UbiB's role in ubiquinone biosynthesis connects it directly to bacterial energy metabolism and respiratory flexibility. Studies on Shewanella species have revealed that most members of this genus, including S. amazonensis, possess both ubiquinones and menaquinones . This dual quinone system enables these bacteria to thrive in diverse environments with varying oxygen availability.

Ubiquinones function as "aerobic quinol" while menaquinones serve as "anaerobic quinol" . This distinction is particularly important for understanding the adaptive capabilities of S. amazonensis, which was isolated from the Amazon River delta and demonstrates remarkable metabolic versatility, capable of utilizing 60 different carbon compounds .

Research has shown that in S. oneidensis, mutants deficient in menaquinone and methylmenaquinone, while maintaining wild-type ubiquinone levels, lose the ability to utilize alternative electron acceptors including nitrate, iron(III), and fumarate . This suggests that the quinone system, which UbiB helps to synthesize, plays a crucial role in the respiratory flexibility of Shewanella species.

The following table summarizes the relationship between quinone types and respiratory conditions in Shewanella:

Quinone TypeRespiratory ConditionFunctionUbiB Involvement
UbiquinonesAerobicPrimary electron carrier in aerobic respirationRequired for biosynthesis
MenaquinonesAnaerobicElectron carrier for alternative electron acceptorsIndirect relationship through cellular redox balance

What experimental approaches are most effective for studying UbiB function in vivo?

Investigating UbiB function in vivo requires specialized approaches due to its membrane localization and involvement in complex metabolic pathways. The following methodologies have proven effective:

  • Gene knockout and complementation studies:

    • Generate ubiB deletion mutants in S. amazonensis

    • Assess phenotypic changes in quinone content using HPLC or LC-MS

    • Perform complementation with wild-type or mutant versions of ubiB

    • Monitor growth under various respiratory conditions

  • Metabolite profiling:

    • Track accumulation of biosynthetic intermediates (particularly octaprenylphenol) in ubiB mutants

    • Use isotope-labeled precursors to trace flux through the ubiquinone biosynthetic pathway

    • Compare metabolic profiles between wild-type and mutant strains under varying oxygen tensions

  • Protein-protein interaction studies:

    • Employ bacterial two-hybrid assays to identify UbiB interaction partners

    • Use co-immunoprecipitation followed by mass spectrometry to identify protein complexes

    • Apply proximity-dependent biotinylation (BioID) adapted for bacterial systems

  • Bioenergetic analyses:

    • Measure membrane potential in wild-type versus ubiB mutant strains

    • Assess respiratory chain function using oxygen consumption rate measurements

    • Quantify ATP production under various growth conditions

When designing these experiments, it's important to consider that UbiB may have indirect effects on cellular physiology through its impact on quinone pools and subsequent effects on electron transport chains.

What are the recommended protocols for functional assays of recombinant UbiB?

Assessing the functional activity of recombinant UbiB presents challenges due to its probable indirect role in the hydroxylation step of ubiquinone biosynthesis. Based on current understanding, the following experimental approaches are recommended:

  • Complementation assays:

    • Transform ubiB-deficient bacterial strains (such as E. coli ubiB mutants) with the recombinant S. amazonensis UbiB

    • Analyze restoration of ubiquinone biosynthesis using HPLC or LC-MS

    • Compare ubiquinone levels and growth characteristics with positive and negative controls

  • In vitro reconstitution systems:

    • Incorporate purified recombinant UbiB into liposomes or nanodiscs

    • Add substrate (octaprenylphenol) and necessary cofactors (ATP, electron donors)

    • Monitor hydroxylation using analytical methods such as LC-MS

  • Protein kinase activity assays:

    • Given that UbiB belongs to a predicted protein kinase family , assess kinase activity using:

      • Radioactive ATP incorporation assays

      • Phospho-specific antibodies to detect substrate phosphorylation

      • Mass spectrometry to identify phosphorylation sites

  • Electron transport coupling assays:

    • Measure the ability of reconstituted UbiB to couple with electron transport components

    • Assess membrane potential generation in proteoliposomes containing UbiB

    • Monitor oxygen consumption in reconstituted systems

When interpreting results from these assays, it's important to consider the possibility that UbiB may function indirectly, potentially by regulating other proteins involved in ubiquinone biosynthesis rather than catalyzing the hydroxylation step directly.

How can CRISPR-Cas9 technology be applied to study UbiB function in Shewanella?

CRISPR-Cas9 gene editing offers powerful approaches for investigating UbiB function in Shewanella amazonensis:

  • Gene knockout strategy:

    • Design sgRNAs targeting the ubiB gene

    • Introduce CRISPR-Cas9 components via conjugation or electroporation

    • Screen for successful knockouts using PCR and sequencing

    • Characterize phenotypes including:

      • Ubiquinone content (expected decrease)

      • Accumulation of precursors (particularly octaprenylphenol)

      • Growth under aerobic versus anaerobic conditions

      • Utilization of different electron acceptors

  • CRISPRi for conditional knockdown:

    • Use deactivated Cas9 (dCas9) fused to transcriptional repressor domains

    • Design sgRNAs targeting the ubiB promoter region

    • Create an inducible system for temporal control of knockdown

    • Monitor dose-dependent effects on ubiquinone biosynthesis

  • Base editing applications:

    • Employ CRISPR base editors to create point mutations in conserved residues

    • Target predicted catalytic or regulatory domains

    • Evaluate the impact of specific amino acid changes on UbiB function

    • Create a library of mutations to map functional domains

  • CRISPR-mediated tagging:

    • Add fluorescent or affinity tags to the endogenous ubiB gene

    • Visualize subcellular localization under different conditions

    • Perform pull-down experiments to identify interaction partners

    • Monitor protein levels in response to environmental changes

When implementing CRISPR-Cas9 in Shewanella, special consideration should be given to the efficiency of homology-directed repair in this organism and potential off-target effects.

How should researchers address apparent contradictions between genomic predictions and phenotypic observations regarding UbiB?

Researchers studying UbiB in S. amazonensis may encounter discrepancies between genomic predictions and experimental observations. The following approaches are recommended for addressing such contradictions:

  • Functional redundancy analysis:

    • Search for paralogous genes in the S. amazonensis genome that might compensate for UbiB function

    • Conduct double or triple knockout experiments to identify redundant pathways

    • Compare with closely related Shewanella species to identify unique versus conserved functions

  • Post-transcriptional regulation investigation:

    • Examine UbiB protein levels versus transcript levels under various conditions

    • Identify potential regulatory RNAs that might influence UbiB expression

    • Assess protein stability and turnover rates in different environments

  • Horizontal gene transfer considerations:

    • Analyze the genomic context of ubiB for evidence of horizontal acquisition

    • Compare codon usage and GC content with the rest of the genome

    • Consider how recently acquired genes might integrate with existing metabolic pathways

  • Environmental context evaluation:

    • Replicate the native environmental conditions of S. amazonensis in laboratory settings

    • Test phenotypes under conditions that mimic the Amazon River delta environment

    • Consider seasonality and environmental fluctuations that might affect gene expression

When confronting contradictory results, it's valuable to remember that genomic predictions are based on homology and computational models, which may not fully capture the unique adaptations of S. amazonensis to its specific ecological niche.

What bioinformatic approaches can enhance our understanding of UbiB structure-function relationships?

Advanced bioinformatic analyses can provide valuable insights into UbiB structure and function:

  • Comparative genomic analysis:

    • Align UbiB sequences across multiple Shewanella species to identify conserved domains

    • Compare with UbiB homologs from diverse bacterial phyla to distinguish core versus variable regions

    • Analyze synteny to understand the genomic context and potential co-evolution with other genes

  • Structural prediction and modeling:

    • Use AlphaFold or similar tools to predict the 3D structure of S. amazonensis UbiB

    • Identify potential substrate binding sites and catalytic residues

    • Model interaction with membrane components and other proteins in the ubiquinone biosynthesis pathway

  • Molecular dynamics simulations:

    • Simulate UbiB behavior within a membrane environment

    • Analyze conformational changes under different conditions

    • Model potential interaction with substrates and cofactors

  • Network analysis:

    • Construct metabolic networks centering on ubiquinone biosynthesis

    • Identify potential regulatory interactions affecting UbiB function

    • Predict metabolic consequences of UbiB perturbation

The table below summarizes key bioinformatic tools for UbiB analysis:

Analysis TypeRecommended ToolsApplication to UbiB Research
Sequence AnalysisBLAST, HMMER, MUSCLEIdentify conserved domains and homologs
Structural PredictionAlphaFold, SWISS-MODELPredict 3D structure and functional sites
Transmembrane PredictionTMHMM, PhobiusIdentify membrane-spanning regions
Pathway AnalysisKEGG, BioCycMap UbiB in metabolic context
Evolutionary AnalysisMEGA, PhyMLTrace evolutionary history of UbiB

What are the emerging technologies that could advance our understanding of UbiB function?

Several cutting-edge technologies show promise for elucidating UbiB function in S. amazonensis:

  • Cryo-electron microscopy:

    • Determine high-resolution structures of UbiB in native membrane environments

    • Visualize UbiB in complex with interaction partners

    • Capture different conformational states during catalytic cycles

  • Single-molecule techniques:

    • Apply FRET to monitor conformational changes in real-time

    • Use optical tweezers to study protein-protein interaction dynamics

    • Implement nano-scopic imaging to visualize UbiB distribution in bacterial membranes

  • Systems biology approaches:

    • Integrate multi-omics data (transcriptomics, proteomics, metabolomics) to understand UbiB in the context of global cellular responses

    • Apply flux balance analysis to predict metabolic consequences of UbiB perturbation

    • Develop mathematical models of ubiquinone biosynthesis incorporating UbiB function

  • Microfluidic evolution experiments:

    • Subject S. amazonensis to controlled evolutionary pressure in microfluidic devices

    • Track mutations in ubiB and related genes under selection

    • Correlate genetic changes with adaptive phenotypes

These technologies, particularly when applied in combination, have the potential to resolve the precise catalytic mechanism of UbiB and its regulatory role in bacterial metabolism.

How might insights from UbiB research impact broader understanding of bacterial adaptation?

Research on S. amazonensis UbiB has implications that extend beyond this specific protein:

  • Respiratory flexibility mechanisms:

    • UbiB's role in ubiquinone biosynthesis contributes to the remarkable respiratory versatility of Shewanella species

    • Understanding how bacteria maintain multiple quinone systems may reveal general principles of metabolic adaptation

  • Evolution of energy metabolism:

    • Comparative analysis of UbiB across bacterial lineages can illuminate how energy transduction systems evolved

    • The protein kinase-like domain in UbiB suggests evolutionary connections between signaling and metabolic pathways

  • Microbial community interactions:

    • Changes in quinone composition affect bacterial competitive fitness in different environments

    • UbiB function may influence how S. amazonensis interacts with other microorganisms in its ecological niche

  • Biotechnological applications:

    • Engineering UbiB and ubiquinone biosynthesis could enhance bacterial production of biofuels or biomaterials

    • Manipulating respiratory flexibility may improve bioremediation capabilities of Shewanella species

The study of UbiB represents a window into fundamental aspects of bacterial physiology at the intersection of energy metabolism, environmental adaptation, and cellular regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.