Recombinant Shewanella baltica ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
atpB; Shew185_4371; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-278
Protein Length
full length protein
Species
Shewanella baltica (strain OS185)
Target Names
atpB
Target Protein Sequence
MAATGEALTPQGYIQHHLTNLQVCATDNGLAVNHACEKAGFWTWHIDSLFFSVGLGVLFL WIFRSVGKKATSGVPGKLQCFVEMIVEFVNNSVKESFHGRNALIAPLALTIFVWVFMMNF MDMIPVDWLPHAASLMGIPYLKAVPTTDVNITFSLAIGVFLLIIFYSIKVKGVSGFVKEL TLQPFNHKAMIPVNLLLETVTLIAKPISLALRLFGNLYAGELIFILIALMYGTNLLLSTL GVTLQLGWLIFHILVITLQAFIFMMLTIVYLSMAHEDH
Uniprot No.

Target Background

Function
This protein plays a crucial role in proton translocation across membranes, acting as a key component of the proton channel.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase and what is the function of the beta subunit in Shewanella baltica?

ATP synthase (EC 3.6.3.14) is the fifth multi-subunit oxidative phosphorylation (OXPHOS) complex that synthesizes ATP from ADP using the energy provided by the proton electrochemical gradient across the membrane . In organisms like Shewanella baltica, ATP synthase plays a crucial role in energy production.

The beta subunit (AtpB) is one of the major components of the F₁ catalytic sector of ATP synthase. It contains nucleotide binding sites and participates directly in the catalytic mechanism of ATP synthesis. The beta subunit works in concert with other subunits through a rotary catalysis mechanism, where conformational changes in the β subunits (located at the interface with adjacent α subunits) allow for ADP and inorganic phosphate binding, ATP formation, and ATP release .

Methodologically, understanding AtpB function in S. baltica requires isolation of the protein complex while maintaining its native conformation, typically through gentle detergent solubilization followed by chromatographic techniques that preserve protein-protein interactions within the complex.

How does Shewanella baltica ATP synthase differ from other bacterial species?

Shewanella baltica ATP synthase shares the fundamental F-type structure common to bacteria but may exhibit adaptations specific to its environmental niche. S. baltica is notable for its ability to thrive in stratified marine environments with varying oxygen levels . This adaptability may be reflected in its ATP synthase properties.

Unlike archaea, which contain A-ATPase/synthase (evolutionarily closer to V-ATPases), S. baltica contains an F-type ATP synthase with one peripheral stalk . This is typical of bacterial F-type ATP synthases, which differ from the more complex V-ATPases found in eukaryotic vacuoles.

When comparing S. baltica with related species like S. oneidensis MR-1 (an electroactive bacterium), both share similar ATP synthase architecture, but may exhibit differences in regulation and expression patterns related to their specific ecological adaptations. S. oneidensis has been studied for genetic code expansion to incorporate non-canonical amino acids into proteins , which represents an approach that could potentially be applied to study S. baltica ATP synthase structure-function relationships.

What genomic information is available for Shewanella baltica ATP synthase genes?

Several complete S. baltica genomes have been sequenced, providing valuable information about ATP synthase genes. Notably, five S. baltica genomes have been recovered from the same sampling station (both simultaneously and 12 years apart), offering insights into genome adaptation over time .

The genomes are approximately 5-5.4 Mb in size with about 46% G+C content, harboring between one to three plasmids . This genomic information provides the foundation for studying ATP synthase genes and their regulation in S. baltica.

For researchers studying the beta subunit specifically, comparative genomic analysis between S. baltica strains can reveal conservation patterns and potential adaptation of ATP synthase genes. For example, the comparison between strains OS183 and BA175 (isolated 12 years apart from the same location) showed that 93% of the detected single nucleotide polymorphisms (SNPs) were contained within six syntenic regions that appeared to have recombined with other members of the S. baltica population .

How can recombinant AtpB from Shewanella baltica be efficiently expressed and purified?

Expression and purification of recombinant S. baltica AtpB requires several careful considerations:

Expression system selection: While E. coli is commonly used for heterologous expression, specific challenges may arise due to the membrane-associated nature of ATP synthase subunits. For studying S. baltica AtpB, researchers might consider:

  • Using E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Expressing AtpB in S. oneidensis MR-1, which offers advantages for expressing proteins from related Shewanella species

Purification strategy: A typical workflow includes:

  • Cell lysis using French press or sonication in buffer containing appropriate detergents (e.g., n-dodecyl β-D-maltoside)

  • Initial purification using affinity chromatography (His-tag or other suitable tags)

  • Further purification by ion-exchange and/or size-exclusion chromatography

Protein solubility considerations: ATP synthase subunits often require specific buffer conditions to maintain stability and native conformation. Based on protocols used for related ATP synthase subunits, a recommended buffer system would include:

Buffer ComponentConcentrationPurpose
HEPES or Tris-HCl pH 7.5-8.050 mMpH stabilization
NaCl100-300 mMIonic strength
Glycerol10%Stability enhancement
DTT or β-mercaptoethanol1-5 mMPreventing disulfide formation
Detergent (e.g., DDM)0.05-0.1%Membrane protein solubilization
Protease inhibitorsAs recommendedPreventing degradation

Researchers working with S. baltica AtpB should verify protein integrity by SDS-PAGE and Western blotting, potentially using antibodies such as those developed against related ATP synthase beta subunits .

What approaches can be used to study the structure-function relationship of Shewanella baltica AtpB?

Several sophisticated approaches can be employed to elucidate structure-function relationships:

Site-directed mutagenesis: Introducing specific mutations at conserved residues can provide insights into catalytic mechanisms. Key targets would include:

  • Nucleotide-binding residues

  • Residues involved in conformational changes during catalysis

  • Interface residues important for interaction with other subunits

Genetic code expansion: As demonstrated with S. oneidensis MR-1, incorporating non-canonical amino acids (ncAAs) allows for site-specific introduction of unique chemical functional groups . This approach could be adapted for S. baltica AtpB to:

Cryo-electron microscopy (cryo-EM): While X-ray crystallography has been used extensively for bovine ATP synthase , cryo-EM offers advantages for membrane protein complexes like ATP synthase. This method could reveal:

Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique provides information about protein dynamics and solvent accessibility, which is crucial for understanding AtpB conformational changes during ATP synthesis.

How do environmental adaptations affect ATP synthase in different Shewanella baltica strains?

S. baltica strains have been isolated from various depths in stratified marine environments, potentially leading to adaptations in ATP synthase function . To study these adaptations:

Comparative genomic analysis: Analysis of ATP synthase gene sequences across S. baltica strains (e.g., OS117, BA175, OS678, OS183, OS625) can reveal selection patterns and evolutionary adaptations . Particularly interesting is the comparison between strains isolated from the same location years apart, which allows for tracking evolutionary changes over time.

Biochemical characterization: Comparing enzymatic properties of ATP synthase from different strains may reveal adaptations to specific environmental conditions:

ParameterExperimental ApproachExpected Adaptation
Temperature optimumATP synthesis assays at various temperaturesAdaptation to environmental temperature
pH optimumActivity measurements across pH rangeReflects environmental pH constraints
Oxygen sensitivityActivity under varying oxygen concentrationsAdaptation to oxygen-limited environments
Salt toleranceActivity assays with varying salt concentrationsAdaptation to salinity gradients

Structural biology approaches: Comparing structures of ATP synthase from different S. baltica strains could reveal subtle adaptations that influence function. These might include differences in subunit interfaces, ion channels, or regulatory sites.

What is the optimal protocol for assessing ATP synthase activity in Shewanella baltica?

ATP synthase activity can be measured using several complementary approaches:

In vitro ATP synthesis assay:

  • Isolate intact ATP synthase or membrane vesicles containing ATP synthase

  • Establish a proton gradient (typically using acidification followed by a rapid pH shift)

  • Add ADP and inorganic phosphate

  • Measure ATP production using luciferase-based assays or HPLC

ATP hydrolysis assay (the reverse reaction):

  • Purify ATP synthase or prepare membrane fractions

  • Add ATP and appropriate buffers

  • Measure inorganic phosphate release using colorimetric methods (e.g., malachite green assay)

  • Calculate specific activity (μmol Pi released/min/mg protein)

Proton pumping assays:

  • Prepare inside-out membrane vesicles

  • Add pH-sensitive fluorescent dyes (e.g., ACMA)

  • Initiate proton pumping by adding ATP

  • Monitor fluorescence changes as indicator of proton movement

Inhibitor sensitivity:
Oligomycin is an inhibitor of proton translocation in ATP synthase, binding to F₀ subunits a and c . Comparing oligomycin sensitivity between different S. baltica strains may reveal functional adaptations.

ATP Synthase SourceExpected IC₅₀ for OligomycinNotes
Standard bacterial F-typeVariable depending on speciesGenerally less sensitive than mitochondrial
S. baltica strainsTo be determined experimentallyMay vary between strains from different environments
Mitochondrial (for comparison)Typically nanomolar rangeHighly sensitive

How can researchers study the assembly and membrane integration of recombinant Shewanella baltica ATP synthase?

Assembly and membrane integration studies require specialized approaches:

Blue Native PAGE (BN-PAGE):

  • Solubilize membranes containing ATP synthase complexes using mild detergents

  • Separate intact complexes by BN-PAGE

  • Analyze subunit composition using second-dimension SDS-PAGE

  • Identify subunits by mass spectrometry or Western blotting

Assembly kinetics using pulse-chase experiments:

  • Label newly synthesized proteins (pulse) with radioactive amino acids

  • Chase with non-radioactive amino acids

  • Analyze complex formation over time by immunoprecipitation and BN-PAGE

  • Determine assembly intermediates and their progression

Membrane topology studies:

  • Use protease accessibility assays to determine exposed regions

  • Apply site-specific labeling using membrane-impermeable reagents

  • Perform cysteine-scanning mutagenesis with accessibility probes

Reconstitution into liposomes:

  • Purify recombinant AtpB or complete ATP synthase complex

  • Prepare liposomes with defined lipid composition

  • Incorporate protein using detergent-mediated reconstitution

  • Verify orientation using protease accessibility assays

  • Measure functional reconstitution by ATP synthesis assays

What techniques are available for studying interactions between AtpB and other ATP synthase subunits in Shewanella baltica?

Several techniques can elucidate protein-protein interactions within the ATP synthase complex:

Cross-linking coupled with mass spectrometry:

  • Apply chemical cross-linkers to stabilize protein interactions

  • Digest cross-linked complexes with proteases

  • Identify cross-linked peptides by mass spectrometry

  • Map interaction interfaces between AtpB and other subunits

Fluorescence resonance energy transfer (FRET):

  • Label AtpB and potential interaction partners with appropriate fluorophores

  • Measure energy transfer as indication of proximity

  • Calculate distances between subunits based on FRET efficiency

Surface plasmon resonance (SPR):

  • Immobilize purified AtpB on sensor chip

  • Flow solutions containing potential interaction partners

  • Measure binding kinetics and affinity constants

Genetic approaches:

  • Perform suppressor mutation analysis to identify compensatory mutations

  • Use bacterial two-hybrid systems to screen for interactions

  • Apply genetic code expansion for site-specific incorporation of photo-crosslinking amino acids

How can researchers differentiate between ATP synthase beta subunit and other related proteins in Shewanella baltica?

Distinguishing the beta subunit from similar proteins requires careful analysis:

Sequence-based identification:

  • Compare protein sequences with known ATP synthase beta subunits from related organisms

  • Identify conserved motifs specific to ATP synthase beta subunits

  • Perform phylogenetic analysis to confirm classification

Immunological approaches:

  • Use specific antibodies against ATP synthase beta subunits for Western blotting

  • Confirm specificity using purified recombinant protein as positive control

  • Consider cross-reactivity with antibodies raised against beta subunits from related organisms

Mass spectrometry-based identification:

  • Perform tryptic digestion of purified protein

  • Analyze peptide fragments by LC-MS/MS

  • Compare peptide mass fingerprints with predicted fragments from S. baltica AtpB

  • Look for post-translational modifications that may be specific to AtpB

What are common challenges in expressing recombinant Shewanella baltica AtpB and how can they be addressed?

Researchers may encounter several challenges:

Poor expression levels:

  • Optimize codon usage for expression host

  • Test different promoter systems (e.g., T7, tac, arabinose-inducible)

  • Vary induction conditions (temperature, inducer concentration, time)

  • Consider fusion partners to enhance expression (e.g., MBP, SUMO)

Protein insolubility/aggregation:

  • Express as fusion with solubility-enhancing tags

  • Optimize buffer conditions (salt concentration, pH, additives)

  • Test different detergents for membrane protein solubilization

  • Consider expression at lower temperatures (16-20°C)

Proteolytic degradation:

  • Use protease-deficient host strains

  • Include appropriate protease inhibitors during purification

  • Optimize extraction and purification speed

  • Identify and modify protease-sensitive regions

Loss of function during purification:

  • Maintain native-like environment using appropriate detergents

  • Include stabilizing ligands (e.g., nucleotides, magnesium)

  • Avoid extreme pH and temperature conditions

  • Consider co-expression with other ATP synthase subunits

ChallengePotential SolutionExpected Outcome
Poor expressionCodon optimization2-10 fold increase in expression
InsolubilityDetergent screeningIdentification of optimal solubilization conditions
DegradationProtease inhibitor cocktailImproved protein integrity during purification
Loss of functionAddition of ATP/ADPStabilization of native conformation

How should researchers interpret discrepancies in experimental results when studying Shewanella baltica ATP synthase?

When encountering discrepancies in results:

Strain-specific differences:

  • Verify the exact strain of S. baltica used (e.g., OS117, BA175, OS678)

  • Compare genomic sequences of ATP synthase genes between strains

  • Consider environmental adaptations that might influence protein function

Experimental conditions:

  • Standardize buffer compositions, pH, and ionic strength

  • Control temperature precisely during enzymatic assays

  • Account for differences in detergents used for membrane protein solubilization

Protein preparation variables:

  • Assess protein purity and integrity by SDS-PAGE and mass spectrometry

  • Verify oligomeric state by size-exclusion chromatography

  • Confirm proper folding using circular dichroism or fluorescence spectroscopy

Methodological differences:

  • Compare direct and indirect assay methods

  • Validate results using multiple independent techniques

  • Consider the impact of different expression systems on protein properties

How can Shewanella baltica AtpB research contribute to understanding bacterial adaptation to environmental changes?

S. baltica's ability to adapt to different environmental conditions makes it an excellent model for studying ATP synthase adaptation:

Comparative genomics approach:

  • Analyze ATP synthase gene sequences from S. baltica strains isolated from different depths

  • Identify mutations that correlate with specific environmental parameters

  • Perform evolutionary analysis to detect signatures of selection

The collection of S. baltica strains isolated from the same station 12 years apart (e.g., OS183 from 1986 and BA175 from 1998) provides a unique opportunity to study evolutionary changes over time . The finding that 93% of SNPs between these strains are concentrated in six syntenic regions suggests that recombination plays a significant role in S. baltica adaptation .

Structure-function studies:

  • Express and characterize AtpB from different S. baltica strains

  • Compare enzymatic properties and stability under various conditions

  • Correlate functional differences with specific amino acid changes

Systems biology integration:

  • Analyze ATP synthase expression patterns under different environmental conditions

  • Study regulatory mechanisms controlling ATP synthase expression

  • Model energy metabolism adaptations in response to environmental changes

What potential applications exist for genetic code expansion in studying Shewanella baltica ATP synthase?

Building on work with S. oneidensis MR-1 , genetic code expansion offers powerful approaches:

Structural biology applications:

  • Incorporate photo-crosslinking amino acids to capture transient protein-protein interactions

  • Add spectroscopic probes at specific sites to monitor conformational changes

  • Introduce heavy atoms or NMR-active nuclei for structural determination

Functional analysis:

  • Replace catalytic residues with close analogs to fine-tune activity

  • Introduce environmentally sensitive fluorescent amino acids to monitor local changes

  • Create photo-switchable variants to control ATP synthase activity with light

Protein engineering:

  • Incorporate click chemistry handles for site-specific modification

  • Add unique functional groups for immobilization or nanoscale assembly

  • Engineer ATP synthase variants with novel properties or substrate specificities

As demonstrated in S. oneidensis MR-1, the genetic code expansion machinery is compatible with endogenous pathways for protein synthesis and maturation . This suggests that similar approaches could be developed for S. baltica, allowing sophisticated manipulation of AtpB for both fundamental research and biotechnological applications.

What are the most promising future research directions for Shewanella baltica ATP synthase studies?

Several emerging areas offer significant potential:

Integration with synthetic biology:

  • Engineering S. baltica ATP synthase with enhanced efficiency or altered specificity

  • Developing minimal ATP synthase systems for synthetic cells

  • Creating hybrid ATP synthases combining features from different organisms

Environmental adaptation mechanisms:

  • Detailed characterization of ATP synthase from S. baltica strains adapted to different depths

  • Experimental evolution studies to track ATP synthase adaptation in real-time

  • Systems biology approaches to understand ATP synthase regulation in changing environments

Nanobiotechnology applications:

  • Harnessing S. baltica ATP synthase for nanoscale energy conversion devices

  • Developing ATP synthase-based molecular motors

  • Creating biosensors based on ATP synthase conformational changes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.