Recombinant Shewanella baltica Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
plsY; Sbal_1149; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Shewanella baltica (strain OS155 / ATCC BAA-1091)
Target Names
plsY
Target Protein Sequence
MSPLTQTLLMILAAYLAGSISSAVLVCRMRGLPDPRLQGSGNPGATNVLRIGGASSAAMV LFFDMLKGAVPSYLAYLMGIDAVSLGLIAIAACLGHIYPVFFGFKGGKGVATAFGAMAPI GDDLAICLMASWVVLLLISRYSSLAAILTALLAPLYTWWLDDRFTIPVAMLSTLIIIRHK DNIQRLLKGEESKVSRKKRPKKS
Uniprot No.

Target Background

Function

This recombinant Shewanella baltica Glycerol-3-phosphate acyltransferase (PlsY) catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). The enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.

Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella baltica Glycerol-3-phosphate acyltransferase (plsY) and what is its biological function?

Shewanella baltica Glycerol-3-phosphate acyltransferase (plsY) is an enzyme that catalyzes the conversion of glycerol-3-phosphate and acyl-CoA to lysophosphatidic acid (LPA), representing the initial and rate-limiting step in glycerolipid synthesis . This reaction is essential for membrane phospholipid biosynthesis in the marine bacterium Shewanella baltica. The enzyme belongs to the acyltransferase family and plays a critical role in S. baltica's membrane biogenesis, particularly during adaptation to environmental stressors such as cold temperatures . Unlike mammalian GPATs that have been extensively characterized, bacterial plsY represents a distinct evolutionary branch of acyltransferases with unique structural and functional properties that contribute to bacterial survival in marine environments.

How does plsY differ from other GPAT enzymes across species?

While plsY and classical GPAT enzymes catalyze similar reactions in glycerolipid synthesis, significant differences exist:

FeatureS. baltica plsYMammalian GPATsPlant GPATs
Number of isoformsSingleFour (GPAT1-4)Multiple
Subcellular localizationCell membraneMitochondria (GPAT1,2) or ER (GPAT3,4)ER, chloroplasts
Substrate specificityNarrower rangeTissue-specific preferencesCan have sn-2 specificity
RegulationEnvironmental stressInsulin/nutritional statusDevelopmental/stress signals
Size~203 amino acidsLarger, multiple domainsVariable
Physiological rolesMembrane synthesis, cold adaptationObesity, insulin resistanceCutin/suberin formation

Notably, plant GPATs can catalyze acylation at the sn-2 position of glycerol-3-phosphate, while most characterized GPATs (including mammalian) acylate the sn-1 position . Mammalian GPATs are classified based on subcellular localization, substrate preferences, and sensitivity to N-ethylmaleimide (NEM) . The evolutionary divergence of these enzymes reflects adaptation to distinct physiological requirements across different kingdoms of life.

What expression systems and conditions are optimal for producing recombinant S. baltica plsY?

Optimal expression of recombinant S. baltica plsY can be achieved following these methodological guidelines:

  • Expression System Selection: E. coli is the preferred host for recombinant expression, as demonstrated by successful production of functional His-tagged protein .

  • Vector Design: pET-based vectors with T7 promoters typically yield high expression levels for bacterial proteins like plsY.

  • Growth and Induction Parameters:

    • Growth temperature: 30°C until induction, then reduce to 16-20°C

    • Media: LB or TB supplemented with appropriate antibiotics

    • Induction: 0.1-0.5 mM IPTG when OD600 reaches 0.6-0.8

    • Post-induction time: 16-20 hours at reduced temperature

  • Cell Lysis Protocol:

    • Buffer composition: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol

    • Detergent: 1% n-Dodecyl β-D-maltoside (DDM) or similar mild detergent

    • Protease inhibitors: Complete protease inhibitor cocktail

    • Lysis method: Sonication or high-pressure homogenization

Maintaining proper membrane protein folding is critical, which is why reduced induction temperature and appropriate detergent selection are essential considerations for functional expression .

What purification strategies yield the highest purity and activity for recombinant S. baltica plsY?

A systematic purification strategy for recombinant His-tagged S. baltica plsY should include:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Resin: Ni-NTA or Co-TALON

    • Binding buffer: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 0.05% DDM, 10-20 mM imidazole

    • Wash buffer: Same as binding buffer with 30-50 mM imidazole

    • Elution buffer: Same as binding buffer with 250-300 mM imidazole

    • Flow rate: 0.5-1 ml/min to ensure complete binding

  • Size Exclusion Chromatography (SEC):

    • Column: Superdex 200 or similar

    • Buffer: 25 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol, 0.03% DDM

    • Collection: Monitor A280 and collect monomeric protein peak

  • Quality Control Assessments:

    • SDS-PAGE: Confirm >90% purity

    • Western blot: Verify identity using anti-His antibodies

    • Enzyme activity assay: Confirm functional integrity

Following purification, the protein should be stored in a stabilizing buffer containing Tris/PBS with 6% trehalose at pH 8.0, with addition of 50% glycerol for long-term storage at -80°C . Aliquoting is essential to avoid repeated freeze-thaw cycles that decrease enzyme activity.

What assays can be employed to accurately measure S. baltica plsY enzymatic activity?

Several complementary approaches can be used to assess plsY activity:

Assay TypeMethodologyAdvantagesLimitations
RadiometricUse of [14C]-glycerol-3-phosphate or [14C]-acyl-CoA substrates with TLC separationHigh sensitivity; direct measurementRequires radioisotope handling; specialized equipment
SpectrophotometricCoupling CoA release to reactions generating chromogenic productsReal-time monitoring; adaptable to plate formatIndirect measurement; potential for interference
HPLC-basedQuantification of substrates/products after reactionDirect measurement; no radioactivityLower throughput; requires standards
Mass spectrometryDetection of LPA productionHigh sensitivity; structural confirmationEquipment-intensive; more complex analysis

For optimal activity measurements, reaction conditions should reflect S. baltica's native environment:

  • Temperature range: 0-25°C (include lower temperatures to assess cold adaptation)

  • pH: 7.5-8.0 (marine pH)

  • Salt concentration: 2-3% NaCl

  • Required cofactors: Mg2+ or Mn2+ (1-5 mM)

  • Detergent: Low CMC detergent to maintain enzyme solubility

These assays provide complementary information about enzyme kinetics, substrate preferences, and the effects of environmental variables on activity.

How does temperature affect S. baltica plsY activity and what are the molecular mechanisms of cold adaptation?

S. baltica demonstrates significant adaptation to cold environments, which extends to its plsY enzyme function:

  • Temperature-Activity Relationship:

    • Activity range: Maintains significant activity at temperatures as low as 0°C

    • Optimal temperature: Likely 15-25°C, reflecting marine environment

    • Thermal stability: Lower stability at temperatures above 30°C compared to mesophilic homologs

  • Cold Adaptation Mechanisms:

    • Structural flexibility: Reduced number of rigid structural elements to maintain catalytic flexibility at low temperatures

    • Reduced hydrophobic core packing: Allows increased conformational mobility at low temperatures

    • Modified active site: Potentially lower activation energy for catalysis

  • Transcriptional Regulation:

    • Cold exposure (8°C) induces complex transcriptional reprogramming in S. baltica

    • RpoE sigma factor is induced while RpoD is repressed during cold stress response

    • This altered transcriptional regulation may affect plsY expression and activity

The ability of S. baltica plsY to function at refrigeration temperatures (0-4°C) contributes to the organism's role in fish spoilage in cold storage . Understanding these cold adaptation mechanisms provides insights into bacterial survival strategies and potential applications in biotechnology.

What is the substrate specificity of S. baltica plsY and how does it compare to GPATs from other organisms?

The substrate specificity of S. baltica plsY can be characterized along several parameters:

  • Acyl Chain Preferences:

    • Chain length: Likely preference for medium to long-chain fatty acids (C14-C18)

    • Saturation: May accommodate both saturated and unsaturated acyl chains

    • Environmental influence: Cold adaptation may favor incorporation of unsaturated fatty acids to maintain membrane fluidity

  • Glycerol-3-Phosphate Binding:

    • Positional specificity: Most bacterial GPATs acylate the sn-1 position, but this needs experimental confirmation for S. baltica plsY

    • Recognition elements: Conserved binding motifs for the phosphate group

  • Comparative Specificity:

    • Versus mammalian GPATs: Mammalian enzymes show tissue-specific preferences and are regulated by metabolic status

    • Versus plant GPATs: Some plant GPATs show unusual sn-2 positional specificity and may have phosphatase activity

Determining the precise substrate specificity profile of S. baltica plsY would provide insights into how this enzyme contributes to membrane adaptation in different environmental conditions and could inform biotechnological applications.

How does S. baltica plsY contribute to bacterial membrane adaptation during cold stress?

S. baltica plsY plays a central role in membrane adaptation during cold stress through several mechanisms:

  • Membrane Fluidity Regulation:

    • Cold temperatures decrease membrane fluidity

    • plsY may alter substrate preference toward unsaturated or branched-chain fatty acids to counteract this effect

    • This "homeoviscous adaptation" maintains appropriate membrane function at low temperatures

  • Integration with Cold Stress Response:

    • S. baltica exhibits massive transcriptional reprogramming during cold stress

    • Upregulation of specific pathways during cold exposure (8°C) includes aminoacyl-tRNA biosynthesis and sulfur metabolism

    • Changes in plsY activity coordinate with other cold-response mechanisms

  • Experimental Evidence:

    • S. baltica strains grow well in cold conditions (0°C)

    • The ability to produce functional membranes at low temperatures contributes to S. baltica's ecological role in fish spoilage during refrigerated storage

  • Membrane Composition Changes:

    • Increased proportion of unsaturated fatty acids

    • Modified phospholipid head group composition

    • Altered lipid-to-protein ratio in membranes

Understanding these adaptation mechanisms provides insights into bacterial survival strategies and could inform approaches for controlling bacterial growth in cold-stored food products.

How can recombinant S. baltica plsY be utilized in structural biology studies?

Recombinant S. baltica plsY offers several opportunities for structural biology investigations:

  • Crystallography Approaches:

    • Purification optimization: Detergent screening to identify conditions that maintain protein stability while promoting crystal formation

    • Crystallization screening: Sparse matrix approaches with membrane protein-specific conditions

    • Structure determination: X-ray diffraction or cryo-EM to resolve atomic structure

    • Ligand co-crystallization: With substrates, products, or inhibitors to capture different conformational states

  • Structural Comparison Framework:

    • Cold-adapted vs. mesophilic enzymes: Identify structural features that facilitate low-temperature activity

    • Bacterial vs. eukaryotic GPATs: Elucidate evolutionary divergence in enzyme architecture

    • Substrate-binding analysis: Define the molecular basis of substrate specificity

  • Structure-Function Studies:

    • Site-directed mutagenesis: Target key residues identified from structural studies

    • Chimeric enzymes: Create hybrid proteins between cold-adapted and mesophilic homologs

    • Domain swapping: Exchange functional domains to pinpoint regions responsible for specific properties

These structural studies would provide fundamental insights into the molecular basis of enzyme function, cold adaptation, and could guide protein engineering efforts for biotechnological applications.

What experimental design principles should guide studies of S. baltica plsY regulation during environmental adaptation?

Rigorous experimental design for studying plsY regulation during environmental adaptation should follow these principles:

  • Control Variable Management:

    • Temperature control: Precise regulation of experimental temperatures is critical

    • Growth phase standardization: Use cultures at identical growth phases across conditions

    • Media composition control: Maintain identical nutrient availability across treatments

    • Time-course design: Sample at multiple timepoints to capture adaptation dynamics

  • Randomized Controlled Design:

    • Randomization: Random assignment of cultures to treatment conditions

    • Sufficient biological replicates: Minimum of 3-5 independent biological replicates

    • Technical replicates: Multiple measurements per biological sample

    • Blind analysis: Where possible, analyze samples without knowledge of treatment group

  • Multi-level Analysis Approach:

    • Transcriptional regulation: RT-qPCR and RNA-seq to measure plsY expression changes

    • Protein levels: Western blotting or proteomics to quantify enzyme abundance

    • Enzyme activity: Biochemical assays under relevant conditions

    • Membrane composition: Lipidomic analysis to correlate with enzyme activity

  • Data Integration Framework:

    • Statistical analysis: Appropriate tests for significance with correction for multiple comparisons

    • Systems biology: Integration of transcriptomic, proteomic, and lipidomic data

    • Mathematical modeling: Develop predictive models of adaptation responses

This systematic approach ensures robust, reproducible data that can elucidate the complex regulation of plsY during environmental adaptation .

How can S. baltica plsY contribute to our understanding of the molecular basis of bacterial fish spoilage?

S. baltica plsY offers a valuable model for investigating the molecular mechanisms of bacterial fish spoilage:

  • Connection to Spoilage Mechanisms:

    • S. baltica is identified as the most important H2S-producing bacterium in fish spoilage

    • Cold-active metabolism enables growth during refrigerated storage

    • Membrane adaptation via plsY activity likely contributes to S. baltica persistence in fish tissues

  • Experimental Approaches:

    • Gene knockout studies: Create plsY mutants to assess impact on growth in fish tissues

    • Expression analysis: Monitor plsY expression during colonization of fish substrates

    • Competitive fitness assays: Compare wild-type and mutant strains during spoilage processes

    • Membrane composition analysis: Correlate lipid profiles with spoilage potential

  • Seasonal Variation Insights:

    • Different Shewanella species dominate fish microbiota depending on season

    • Summer: Mesophilic S. algae initially dominates

    • Winter and after cold storage: S. baltica becomes predominant

    • PlsY likely contributes to this ecological succession through cold adaptation

  • Applications in Food Safety:

    • Potential targeting of plsY as a preservation strategy

    • Development of plsY inhibitors specific to Shewanella species

    • Biomarkers for early detection of spoilage potential in fish products

This research direction connects basic enzymology to practical applications in food safety and preservation technologies.

How do the biochemical properties of S. baltica plsY compare with GPATs from other Shewanella species?

Comparative analysis of plsY across Shewanella species reveals important insights into adaptation and function:

Shewanella SpeciesEnvironmental NicheNotable plsY FeaturesRelation to Cold Adaptation
S. balticaBaltic Sea, fish microbiotaActive at 0°C; dominant in cold-stored fishHigh cold tolerance; grows well at 0°C
S. algaeWarmer waters; can be pathogenicLess cold-tolerant; mesophilicDominates in summer; replaced by S. baltica in cold storage
S. woodyiDeep sea, bioluminescentPotential pressure adaptationSequence similarity to S. baltica plsY (see alignments)
S. oneidensisFreshwater, metal-reducingWell-characterized model organismDifferent environmental adaptations than marine species

Key findings from comparative analyses:

  • Sequence conservation in catalytic domains reflects essential enzymatic function

  • Variable regions potentially contribute to specific environmental adaptations

  • Cold adaptation correlates with specific amino acid substitutions that enhance flexibility

  • Differential gene expression regulation (e.g., sigma factor utilization) during stress response

These comparative insights provide a framework for understanding how evolutionary pressures shape enzyme function in different environments.

What are the potential biotechnological applications of recombinant S. baltica plsY?

Recombinant S. baltica plsY offers several promising biotechnological applications:

  • Cold-Active Biocatalysis:

    • Enzyme-mediated synthesis of specialty lipids at low temperatures

    • Reduced energy requirements compared to mesophilic enzymes

    • Potential for producing structured lipids with specific fatty acid compositions

  • Food Safety Applications:

    • Development of specific inhibitors targeting S. baltica plsY as food preservatives

    • Biosensors for early detection of Shewanella contamination in seafood

    • Competitive exclusion strategies based on membrane lipid metabolism

  • Membrane Engineering:

    • Designer membrane lipid composition for industrial microorganisms

    • Enhanced cold tolerance in industrial production strains

    • Optimization of membrane properties for specific biotechnological processes

  • Fundamental Research Tool:

    • Model system for studying membrane adaptation mechanisms

    • Platform for understanding structure-function relationships in acyltransferases

    • Template for protein engineering of novel acyltransferases with desired properties

These applications leverage the unique properties of S. baltica plsY, particularly its cold adaptation and role in membrane biogenesis, to address challenges in biotechnology and food science.

What future research directions would most advance our understanding of S. baltica plsY function and applications?

Priority research directions to advance understanding of S. baltica plsY include:

  • Structural Biology:

    • High-resolution crystal structure determination

    • Molecular dynamics simulations to understand conformational changes during catalysis

    • Structure-guided mutagenesis to define the catalytic mechanism

  • Systems Biology Integration:

    • Multi-omics studies correlating plsY expression with lipidome changes during environmental adaptation

    • Metabolic flux analysis to quantify the contribution of plsY to membrane lipid turnover

    • Network analysis of plsY interactions with other membrane biogenesis components

  • Comparative Enzymology:

    • Detailed kinetic analysis across temperature ranges compared with mesophilic homologs

    • Substrate specificity profiling using diverse acyl-CoA substrates

    • Directed evolution to enhance desired catalytic properties

  • Applied Research:

    • Development of high-throughput screening systems for plsY inhibitors

    • Engineering plsY variants with enhanced stability or altered specificity

    • Application in biocatalytic production of specialty lipids

  • Ecological Studies:

    • Correlation of plsY sequence variants with ecological distribution of Shewanella species

    • In situ expression studies in natural environments

    • Competitive fitness assays in relevant environmental conditions

These research directions would significantly advance both fundamental understanding of plsY biology and potential biotechnological applications of this important enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.