Recombinant Shewanella baltica Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Mechanism of Action

YidC functions as a membrane insertase through two pathways:

  • Sec-independent insertion: Direct integration of small, single-pass membrane proteins (e.g., phage Pf3 coat protein) into lipid bilayers .

  • SecYEG collaboration: Assists in folding and lateral release of transmembrane helices from the Sec translocon during co-translational insertion .

Structural studies using cryo-EM reveal that YidC binds ribosomes at the tunnel exit, positioning substrates at the protein-lipid interface for insertion . The C-terminal region of Shewanella baltica YidC enhances ribosome binding, mimicking mitochondrial Oxa1 homologs .

Key Findings

  • Catalytic Efficiency: In vitro reconstitution demonstrates that YidC proteoliposomes insert ~150 Pf3 coat proteins per YidC molecule, indicating enzymatic turnover .

  • Substrate Specificity: Prefers proteins with short translocated domains and 1–2 transmembrane segments (e.g., MscL, ATP synthase subunit c) .

  • Chaperone Activity: Prevents aggregation of transmembrane helices post-SecYEG release, aiding folding of respiratory complexes .

Comparative Analysis

FeatureShewanella baltica YidCEscherichia coli YidC
C-terminal RegionPositively charged, ribosome-binding Shorter, lacks ribosome affinity
Sec-independenceSupports Pf3 insertion in vitro Requires SRP for most substrates
Structural ModelCryo-EM resolved ribosome-YidC complex Crystal structure available (5-transmembrane core)

Technical Considerations

  • Storage Stability: Avoid repeated freeze-thaw cycles; glycerol stabilizes reconstituted protein .

  • Activity Assays: Functional validation via in vitro membrane insertion assays using radiolabeled substrates .

  • Limitations: Not suitable for human therapeutic use due to bacterial origin .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes. We will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. For dry ice shipment, please contact us in advance; additional fees will apply.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize your request.

Synonyms
yidC; Sbal_4380; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Shewanella baltica (strain OS155 / ATCC BAA-1091)
Target Names
yidC
Target Protein Sequence
MESQRNILLIGLLFVSFLLWQQWQADKAPKPVATESSLVANAANSHSADVPEADTGVPAA VTATSKLITVKTDQLDVQINPIGGDIVFAALVSHKMEQDKDQPFVLLEQTKDFTYIAQSG LIGRDGIDSSAKGRAAFSTAATEYTLAEGQDTLEVPLTYVADNGVTYTKVFVFHRGKFNV DVDYKINNTSAAPLQVQMYGQIKQTIKPSESSMVMPTYRGGAFSTQDVRYEKYKFDDMAK SNLNQATLGGWAAMLQHYFVSAWIPPATDSNTIFSSVSAGGLANIGFRGAVYDIAPGATQ EISSQFYVGPKDQKALSAISDTLNLVVDYGFLWWLAVPIHWLLMFYQSFVGNWGMAIILI TLTVRGLLFPLTKAQYTSMAKMRNLQPKLTDLKERFGDDRQKMGQAMMELYKKEKVNPMG GCLPIILQMPIFIALYWVLLESFELRHAPFMLWIHDLSVQDPYYILPLLMGVSMFVMQKM QPIAPTMDPMQVKMMQWMPVIFTVFFLWFPAGLVLYWLVGNIVAITQQKIIYAGLAKKGL K
Uniprot No.

Target Background

Function

Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It plays a role in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. Furthermore, it facilitates the folding of multispanning membrane proteins.

Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its primary function in Shewanella baltica?

YidC in Shewanella baltica is a membrane protein insertase that plays a crucial role in the integration of newly synthesized proteins into the bacterial cytoplasmic membrane. As part of the membrane protein biogenesis machinery, YidC functions as a molecular chaperone that facilitates the proper folding and membrane insertion of transmembrane proteins .

The S. baltica YidC protein (541 amino acids) contains multiple transmembrane domains and conserved functional regions that enable it to interact with nascent polypeptide chains emerging from the ribosome. YidC can operate either independently as a membrane insertase for Sec-independent proteins, or in conjunction with the SecYEG translocon complex for more complex membrane proteins . This dual functionality makes YidC essential for maintaining membrane proteostasis in S. baltica.

What experimental systems have been developed to study S. baltica YidC function?

Researchers have developed several experimental systems to investigate S. baltica YidC function:

  • Recombinant protein expression systems: Full-length S. baltica YidC has been successfully expressed in E. coli with N-terminal His-tags, facilitating purification and in vitro studies .

  • Reconstituted proteoliposome systems: Purified YidC can be reconstituted into liposomes to study its membrane insertion activity in vitro, similar to studies performed with E. coli YidC .

  • Complementation assays: YidC-depleted bacterial strains can be used to assess functional conservation between S. baltica YidC and homologs from other species.

  • Cryo-electron microscopy: Structural studies of YidC-ribosome complexes provide insights into how YidC interacts with the ribosomal tunnel exit during co-translational membrane insertion .

What are the optimal conditions for expressing and purifying recombinant S. baltica YidC?

The optimal expression and purification protocol for recombinant S. baltica YidC involves several critical steps:

Expression system:

  • Host: E. coli expression system (typically BL21(DE3) or similar strains)

  • Vector: pET-based vectors containing N-terminal His-tag

  • Induction: IPTG (0.1 mM) at mid-log phase

  • Growth temperature: Reduced temperature (16-20°C) post-induction minimizes inclusion body formation

Purification protocol:

  • Cell lysis in Tris/PBS-based buffer with protease inhibitors

  • Membrane fraction isolation by ultracentrifugation

  • Solubilization using mild detergents (e.g., DDM or LDAO)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for higher purity

Storage conditions:

  • Storage at -20°C/-80°C in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Avoid repeated freeze-thaw cycles

  • For long-term storage, add 5-50% glycerol (recommended final concentration: 50%)

How can researchers assess the functional activity of recombinant S. baltica YidC in vitro?

Several complementary approaches can be used to assess the functional activity of recombinant S. baltica YidC:

Membrane insertion assays:

  • Proteoliposome reconstitution: Purified YidC is incorporated into liposomes

  • In vitro translation: Model membrane proteins (e.g., Pf3 coat protein) are synthesized in the presence of YidC-containing proteoliposomes

  • Insertion analysis: Successful insertion is assessed by protease protection assays or membrane fractionation

Binding assays:

  • Co-sedimentation assays: Measuring binding of YidC to ribosomes or substrate proteins

  • Fluorescence-based assays: Using labeled substrates to monitor interaction with YidC

  • Surface plasmon resonance: Quantifying binding kinetics between YidC and potential interaction partners

Functional complementation:

  • YidC-depleted strains: Complementation with S. baltica YidC to rescue growth defects

  • Substrate insertion analysis: Monitoring insertion of known YidC-dependent proteins in vivo

What are the key considerations when designing experiments to investigate YidC-mediated insertion mechanisms?

When investigating YidC-mediated insertion mechanisms, researchers should consider:

Substrate selection:

  • Model substrates like Pf3 coat protein have been established for YidC studies

  • Different substrates may have varying dependencies on YidC (fully dependent vs. YidC-enhanced insertion)

  • The hydrophobicity of transmembrane segments affects insertion efficiency and YidC dependence

Distinguishing Sec-dependent vs. Sec-independent pathways:

  • Some substrates require both YidC and SecYEG

  • SecA inhibitors (e.g., sodium azide) or SecY-deficient systems can help isolate YidC-only functions

Experimental controls:

  • Mutant substrates with extended hydrophobic regions can insert independently of YidC (useful controls)

  • YidC mutants lacking key functional domains serve as negative controls

  • Comparative studies with E. coli YidC provide reference points

Membrane environment considerations:

  • Lipid composition affects insertion efficiency

  • Temperature influences membrane fluidity and insertion dynamics

  • Ionic strength and pH must be controlled in in vitro systems

How does S. baltica YidC interact with the ribosome during co-translational membrane protein insertion?

S. baltica YidC interacts specifically with the ribosome at the exit tunnel during co-translational membrane protein insertion. Cryo-electron microscopy studies of YidC-ribosome complexes have revealed that a single copy of YidC interacts with the ribosome, positioning itself to receive nascent membrane proteins as they emerge .

Key aspects of this interaction include:

  • Ribosome binding site: YidC interacts with the ribosome primarily through its cytoplasmic domains, particularly the C-terminal region and the helical hairpin between TM2 and TM3 .

  • Insertion site formation: The interaction creates a protected environment at the YidC protein-lipid interface where nascent membrane proteins can enter the lipid bilayer.

  • Positional dynamics: During insertion, YidC undergoes conformational changes that facilitate the lateral movement of transmembrane segments from the YidC interior to the lipid phase.

This interaction represents a fundamental mechanism for co-translational membrane protein biogenesis that is conserved across bacterial species, though species-specific variations in the interaction interface may exist.

What is known about the structure-function relationship of specific domains in S. baltica YidC?

The structure-function relationship of S. baltica YidC can be understood through its domain organization:

DomainPositionFunction
N-terminal domain1-40Species-specific region; may facilitate membrane targeting
Periplasmic domain41-340Contains conserved motifs; involved in substrate recognition
TM1~341-365Membrane anchoring; contributes to hydrophobic core
TM2~371-391Forms part of the substrate binding pocket
TM3~401-421Essential for insertase activity
TM4~425-445Contributes to the hydrophobic environment for substrate insertion
TM5~450-470Forms part of the lateral gate for substrate release
C-terminal domain471-541Contains ribosome binding elements and species-specific sequences

The five transmembrane domains form a distinctive arrangement with a hydrophilic groove that likely facilitates the insertion of membrane proteins . The helical hairpin between TM2 and TM3 on the cytoplasmic surface is particularly important for ribosome interaction during co-translational insertion.

Molecular dynamics simulations suggest that the transmembrane domains create a flexible environment that can adapt to different substrate proteins while maintaining the integrity of the membrane barrier during insertion.

How does the mechanism of YidC-dependent vs. Sec-dependent membrane protein insertion differ in S. baltica?

In S. baltica, as in other bacteria, membrane protein insertion follows either a YidC-dependent or a Sec-dependent pathway, with distinct mechanisms:

YidC-dependent insertion mechanism:

  • Functions independently of the Sec machinery

  • Directly facilitates insertion of small, relatively simple membrane proteins

  • Creates a hydrophilic environment within its core that guides transmembrane segments into the lipid bilayer

  • Does not require ATP for insertion (energy-independent process)

  • Example substrate: Pf3 coat protein can be efficiently inserted into YidC-containing proteoliposomes without Sec components

Sec-dependent insertion mechanism:

  • Requires the SecYEG translocon complex

  • Often utilizes SecA ATPase for providing insertion energy

  • Handles larger and more complex membrane proteins

  • May also involve YidC for certain substrates (YidC-SecYEG cooperation)

  • Forms a lateral gate for releasing transmembrane segments into the lipid bilayer

Hybrid pathway:

  • Some substrates utilize both systems

  • YidC may accept substrates from the Sec machinery and facilitate their final integration

  • This cooperation ensures proper insertion and folding of complex membrane proteins

Studies with E. coli YidC have demonstrated that certain proteins can insert via YidC alone, while modified versions with extended hydrophobic regions can insert independently but are accelerated by YidC presence . Similar mechanisms likely apply to S. baltica YidC.

How does YidC function compare between S. baltica and other Shewanella species?

YidC function among different Shewanella species shows both conservation and adaptation:

Conserved features:

  • Core structure with five transmembrane domains

  • Essential role in membrane protein insertion

  • Ability to function independently or with SecYEG

  • Ribosome interaction during co-translational insertion

Species-specific adaptations:

  • S. baltica YidC (541 aa) compared to S. putrefaciens YidC shows high sequence conservation in the transmembrane domains but some variability in the periplasmic domain

  • These differences may reflect adaptation to specific ecological niches and membrane protein requirements

  • Cold-adapted Shewanella species may have YidC variants optimized for function at lower temperatures

Functional studies comparing YidC activity between Shewanella species would provide valuable insights into how this essential membrane insertase has evolved in bacteria adapted to different environmental conditions, particularly in psychrophilic (cold-loving) species like S. baltica.

What role might YidC play in S. baltica's adaptation to environmental conditions?

S. baltica is a psychrotrophic bacterium capable of growth at temperatures as low as 0°C, with an optimal growth temperature around 25°C . YidC likely plays several critical roles in S. baltica's environmental adaptation:

Cold adaptation:

  • Ensures proper membrane protein insertion at low temperatures

  • Maintains membrane integrity and function under cold stress

  • May have structural adaptations for flexibility at lower temperatures

Anaerobic respiration:

  • S. baltica can use various terminal electron acceptors for anaerobic respiration

  • YidC likely facilitates insertion of respiratory chain components and enzymes required for this metabolic versatility

  • This function would be essential for survival in oxygen-limited environments

Biofilm formation and quorum sensing:

  • S. baltica forms biofilms, which require proper membrane protein biogenesis

  • While not directly involved in quorum sensing, YidC ensures proper insertion of membrane receptors and transporters that may participate in these processes

  • The biofilm lifestyle is important for S. baltica's ecological success and spoilage potential

How can evolutionary analysis of YidC across bacterial species inform structural studies?

Evolutionary analysis of YidC across bacterial species provides valuable insights for structural studies:

Evolutionary co-variation analysis:

  • Residues that co-evolve often indicate physical proximity in the three-dimensional structure

  • This approach has been successfully used to develop structural models of YidC

  • Highly conserved residues typically indicate functional importance

Conservation patterns:

  • The five transmembrane domains show the highest conservation across species

  • The cytoplasmic regions involved in ribosome binding also show significant conservation

  • Species-specific variations may indicate adaptation to different membrane environments

Functional divergence:

  • Comparative analysis between YidC homologs (including mitochondrial Oxa1p and chloroplast Alb3) reveals evolutionary adaptations

  • These comparisons help identify core functional elements versus adaptable regions

  • Understanding this evolutionary context enhances interpretation of structural data

A comprehensive phylogenetic analysis combined with structural studies can reveal how YidC has evolved while maintaining its essential function across diverse bacterial species and environments.

What emerging technologies could advance our understanding of S. baltica YidC function?

Several emerging technologies hold promise for advancing our understanding of S. baltica YidC:

Cryo-electron tomography:

  • Visualizing YidC in its native membrane environment

  • Observing YidC-ribosome complexes during active translation

  • Capturing different states of the insertion process

Single-molecule techniques:

  • FRET-based approaches to monitor conformational changes during insertion

  • Optical tweezers to measure forces involved in membrane protein integration

  • Single-particle tracking to observe YidC dynamics in membranes

Advanced computational approaches:

  • AI-enhanced molecular dynamics simulations of insertion processes

  • Improved structural prediction methods for membrane protein complexes

  • Systems biology models integrating YidC function with cellular physiology

Genome engineering tools:

  • CRISPR-Cas9 systems adapted for Shewanella species

  • Site-specific mutagenesis to create functional variants

  • Development of regulatable expression systems for conditional studies

What unresolved questions about S. baltica YidC warrant further investigation?

Despite progress in understanding YidC function, several key questions remain:

  • Substrate specificity determinants: What features of membrane proteins determine their dependence on YidC for insertion?

  • Energetics of insertion: How does YidC facilitate membrane crossing without an obvious energy source?

  • Interaction network: What proteins beyond the ribosome and Sec machinery interact with YidC in S. baltica?

  • Regulatory mechanisms: How is YidC expression regulated under different environmental conditions?

  • Role in pathogenesis: Does YidC contribute to S. baltica's ability to cause food spoilage through specific membrane protein clients?

  • Structural dynamics: What conformational changes occur in YidC during the insertion cycle?

  • Adaptation mechanisms: How has S. baltica YidC evolved specific features for function at low temperatures?

Addressing these questions would significantly advance our understanding of membrane protein biogenesis in S. baltica and potentially reveal novel aspects of bacterial adaptation to specialized environmental niches.

How can S. baltica YidC be utilized for heterologous membrane protein expression?

S. baltica YidC holds potential for improving heterologous membrane protein expression:

Cold-adapted expression systems:

  • S. baltica YidC could be incorporated into expression hosts for cold-temperature protein production

  • This may improve folding and stability of difficult membrane proteins

  • Particularly valuable for psychrophilic membrane proteins that are challenging to express in mesophilic hosts

Co-expression strategies:

  • Expressing S. baltica YidC alongside target membrane proteins

  • May enhance insertion efficiency and proper folding

  • Could be especially useful for membrane proteins that aggregate at higher temperatures

Engineered insertion systems:

  • Creating chimeric YidC proteins with enhanced substrate range

  • Developing specialized proteoliposome systems for in vitro membrane protein reconstitution

  • Optimizing YidC-based cell-free expression systems for membrane protein production

What methods can be used to investigate the interactome of S. baltica YidC?

To investigate the S. baltica YidC interactome, researchers can employ:

Affinity-based approaches:

  • Pull-down assays using tagged YidC as bait

  • Chemical crosslinking followed by mass spectrometry (XL-MS)

  • Proximity labeling techniques (BioID, APEX) to identify neighboring proteins

Genetic approaches:

  • Suppressor screens to identify genetic interactions

  • Synthetic lethality analysis

  • Two-hybrid or split-fluorescent protein assays adapted for membrane proteins

Structural approaches:

  • Cryo-EM of YidC-containing complexes

  • HDX-MS (Hydrogen-deuterium exchange mass spectrometry) to map interaction surfaces

  • NMR studies of soluble domains and their interactions

Computational predictions:

  • Coevolution-based interactome prediction

  • Molecular docking simulations

  • Network analysis based on transcriptomics data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.