Recombinant Shewanella baltica Translation initiation factor IF-3 (infC)

What is Translation initiation factor IF-3 (infC) and what is its role in Shewanella baltica?

Translation initiation factor IF-3 is a critical protein in bacterial translation that binds to the 30S ribosomal subunit and shifts the equilibrium between 70S ribosomes and their 50S and 30S subunits in favor of the free subunits. This function enhances the availability of 30S subunits on which protein synthesis initiation begins . In Shewanella baltica, particularly strain OS185, IF-3 consists of 180 amino acids and belongs to the IF-3 protein family . The protein plays a crucial role in regulating translation initiation, which is particularly important during environmental adaptation processes such as response to cold stress, where S. baltica must adjust its protein synthesis machinery to maintain cellular function . The modulation of translation initiation is one of the strategies S. baltica employs to survive in changing marine environments, including temperature fluctuations that affect the Baltic Sea ecosystem.

What are the key characteristics of Shewanella baltica as a research organism?

Shewanella baltica is a gram-negative, facultatively anaerobic marine bacterium with several characteristics that make it valuable for research:

• Ecological significance: S. baltica plays a major role in denitrification and bioremediation in marine environments .

• Redox versatility: The species can utilize a variety of terminal electron acceptors, making it important in biogeochemical cycling .

• Distinct ecotypes: Multiple strains have been isolated from different depths in the Baltic Sea, each adapted to specific environmental conditions .

• Cold adaptation: S. baltica can survive at low temperatures and is responsible for spoilage of ice-stored seafood, showing specific transcriptional responses to cold stress .

• Genetic diversity: Different strains show significant transcriptional variation even when grown under identical conditions .

Research with S. baltica often involves studying its adaptability to environmental stressors. For instance, when comparing growth rates of four strains (OS155, OS185, OS195, and OS223) in defined medium with glucose as the sole carbon source, researchers found significantly different doubling times:

These variations in growth characteristics demonstrate the ecological specialization of S. baltica strains and their adaptation to specific environmental niches .

What methods are recommended for cloning and expressing recombinant S. baltica IF-3?

For successful cloning and expression of recombinant S. baltica IF-3, the following methodological approach is recommended:

• Gene amplification: PCR-amplify the infC gene from S. baltica genomic DNA using primers designed based on the known sequence (partial sequence: MKIKKTAGRQPAPNRINEEITGVPEVRLTGIDGEAIGVVSIRDAQNLADEAGVDLVEISPNAEPPVC) .

• Cloning strategy: Insert the amplified gene into an appropriate expression vector with a compatible promoter system. T7-based expression systems are often effective for bacterial proteins.

• Expression host selection: While E. coli is commonly used, consider that S. baltica proteins may have specific requirements. For optimal expression, test multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express) to address potential codon bias issues.

• Expression conditions optimization: Test various induction temperatures (15-37°C), IPTG concentrations (0.1-1.0 mM), and induction times (3-24 hours). Given S. baltica's cold adaptation, lower temperatures (15-20°C) may yield better results for soluble protein expression .

• Protein purification: Implement a two-step purification process, typically involving affinity chromatography followed by size exclusion chromatography. For IF-3, include ribonuclease treatment to remove bound RNA that might co-purify.

When working with recombinant DNA, researchers must comply with institutional biosafety protocols and NIH Guidelines for Research Involving Recombinant DNA Molecules. This includes obtaining appropriate approvals from the Institutional Biosafety Committee (IBC) prior to initiating any recombinant DNA work classified as III-A through III-D .

How can researchers verify the functional activity of recombinant S. baltica IF-3?

Verifying the functional activity of recombinant S. baltica IF-3 requires multiple complementary approaches:

• Ribosome binding assay: Measure the binding affinity of purified IF-3 to isolated 30S ribosomal subunits using filter binding assays or fluorescence anisotropy if the protein is fluorescently labeled.

• Subunit anti-association test: Quantify the ability of IF-3 to prevent association of 30S and 50S ribosomal subunits under conditions that normally promote 70S formation. This can be monitored by light scattering or analytical ultracentrifugation.

• In vitro translation system: Establish a reconstituted translation system using purified components to measure IF-3 activity in promoting correct translation initiation. Compare the activity of recombinant IF-3 with native IF-3 or with IF-3 from related organisms.

• Complementation studies: Test whether recombinant S. baltica IF-3 can functionally complement an E. coli infC conditional mutant strain under restrictive conditions.

• Structural integrity assessment: Use circular dichroism (CD) spectroscopy to compare the secondary structure profile of recombinant IF-3 with predicted structures or known profiles of IF-3 proteins from related organisms.

For quantitative analysis, researchers should establish a dose-response curve of IF-3 activity in ribosome binding or translation initiation assays, which will allow for comparisons between wild-type and mutant forms of the protein in future studies.

How does temperature affect the expression and function of IF-3 in S. baltica?

Temperature significantly impacts both the expression and function of IF-3 in S. baltica, which is particularly relevant given the organism's role in cold adaptation processes:

• Gene expression changes: RNA sequencing and RT-qPCR validation studies have shown that exposure to cold stress (8°C) causes substantial transcriptional reprogramming in S. baltica, affecting approximately 70% of differentially expressed genes . While many genes are downregulated, several genes involved in translation may be upregulated to maintain protein synthesis under cold conditions.

• Post-transcriptional regulation: Cold stress in S. baltica affects RNA chaperones and helicases that resolve secondary structures in mRNA, which can impact the translation initiation process where IF-3 functions. Specifically, orthologs of cold-shock proteins in S. baltica (encoded by Shew185_1705 and Shew185_1464) showed significant upregulation at both 90 and 180 minutes after cold stress onset .

• Protein activity modulation: Low temperatures can affect the binding kinetics of IF-3 to the 30S ribosomal subunit, potentially requiring compensatory mechanisms to maintain translation efficiency.

• Structural adaptations: The IF-3 protein may undergo conformational changes at different temperatures, affecting its interaction with the ribosome. Marine bacteria like S. baltica often possess molecular adaptations that allow protein function across temperature ranges.

The relationship between temperature and IF-3 function is particularly important in understanding how S. baltica maintains translation during environmental stress, potentially contributing to its ability to cause food spoilage at refrigeration temperatures. Researchers studying these processes should consider both direct effects on the IF-3 protein and broader transcriptional changes affecting translation machinery.

What are the differences in infC expression patterns among S. baltica ecotypes?

S. baltica strains isolated from different depths in the Baltic Sea represent distinct ecotypes with significant transcriptional variations, including differences in infC expression patterns:

When studying infC expression in S. baltica, researchers should consider:

• The specific strain being investigated and its ecological origin

• Growth conditions that may trigger differential expression

• Potential co-regulation with other translation factors

• The relationship between expression level and growth rate

These considerations are essential for accurately interpreting experimental results and understanding the ecological significance of observed differences.

How can site-directed mutagenesis be used to investigate structure-function relationships in S. baltica IF-3?

Site-directed mutagenesis provides a powerful approach to investigate structure-function relationships in S. baltica IF-3, allowing researchers to precisely modify specific amino acid residues and observe the resulting effects on protein function:

• Target selection strategy:

  • Conserved residues identified through multiple sequence alignment of IF-3 from various Shewanella species

  • Residues in the N-terminal and C-terminal domains known to interact with the 30S ribosomal subunit

  • Linker region residues that contribute to flexibility between domains

  • Charged residues potentially involved in RNA interaction

• Recommended mutagenesis workflow:
  a. Generate single amino acid substitutions using overlap extension PCR or commercial mutagenesis kits
  b. Express and purify mutant proteins using identical conditions as wild-type
  c. Perform comparative functional assays (ribosome binding, anti-association activity)
  d. Analyze structural changes using biophysical techniques (CD spectroscopy, thermal stability assays)

• Critical residues to target:

  • Positively charged residues (Lys, Arg) likely involved in RNA binding

  • Glycine residues in the linker region that may contribute to interdomain flexibility

  • Hydrophobic core residues that maintain structural integrity

• Functional assessment:

  • Quantify changes in 30S binding affinity using microscale thermophoresis or surface plasmon resonance

  • Measure impacts on translation initiation using reconstituted in vitro translation systems

  • Assess changes in protein stability using differential scanning fluorimetry

When designing mutagenesis experiments, researchers should consider incorporating controls such as conservative mutations (maintaining charge or size) and non-conservative mutations to distinguish between structural and functional effects. The results should be interpreted in the context of the known role of IF-3 in shifting the equilibrium between 70S ribosomes and their subunits .

What experimental approaches are optimal for studying the role of IF-3 in S. baltica adaptation to environmental stressors?

To comprehensively investigate the role of IF-3 in S. baltica adaptation to environmental stressors, researchers should implement a multi-faceted experimental approach:

• Transcriptomic profiling under stress conditions:

  • Perform RNA-seq analysis of S. baltica exposed to relevant stressors (cold stress, nutrient limitation, salinity changes)

  • Monitor infC expression levels relative to other translation factors

  • Validate findings with RT-qPCR using the methodology described for cold stress studies

• Protein expression and modification analysis:

  • Quantify IF-3 protein levels using Western blotting during stress response

  • Investigate post-translational modifications using mass spectrometry

  • Examine IF-3 half-life under different stress conditions using pulse-chase experiments

• Genetic manipulation approaches:

  • Develop a regulated expression system for infC to manipulate IF-3 levels

  • Construct strain variants with modified infC promoters to alter expression patterns

  • Perform complementation studies with infC variants from different S. baltica ecotypes

• Ribosome profiling during stress response:

  • Implement ribosome profiling to capture translation dynamics during stress adaptation

  • Correlate changes in translation initiation patterns with IF-3 activity

  • Compare profiles across multiple S. baltica strains (OS155, OS185, OS195, OS223)

• Protein-protein interaction network:

  • Identify stress-specific IF-3 interaction partners using pull-down assays coupled with mass spectrometry

  • Validate interactions using bacterial two-hybrid systems or fluorescence resonance energy transfer

When implementing these approaches, researchers should consider the specific growth characteristics of different S. baltica strains, as they show significantly different doubling times even under optimal conditions (ranging from 2.05h for OS155 to 13.3h for OS223) . Experimental timelines should be adjusted accordingly to capture comparable physiological states across strains.

What biosafety regulations must researchers follow when working with recombinant S. baltica IF-3?

Researchers working with recombinant S. baltica IF-3 must adhere to specific biosafety regulations to ensure compliance and safety:

When designing experiments, researchers should consult with their institutional biosafety officer early in the planning process to ensure all regulatory requirements are addressed before commencing work with recombinant S. baltica IF-3.

What are the optimal methods for isolating and analyzing native IF-3 from S. baltica for comparison with recombinant variants?

To effectively isolate and analyze native IF-3 from S. baltica for comparative studies with recombinant variants, researchers should employ the following optimized methodology:

• Cultivation strategy:

  • Grow S. baltica in defined medium based on modified M1 medium containing appropriate carbon sources

  • Harvest cells at mid-exponential phase (OD₆₀₀ = 0.4) for consistent protein expression levels

  • Consider strain-specific growth rates when planning harvesting times (OS155: 7.5h; OS195: 35h; OS185: 50h; OS223: 55h)

• Native protein isolation protocol:
  a. Cell lysis:

  • Resuspend cell pellets in ribosome buffer containing protease inhibitors

  • Disrupt cells using French pressure cell or sonication under cooling conditions

  • Clarify lysate by centrifugation (30,000 × g, 30 min, 4°C)

  b. Ribosome isolation and IF-3 extraction:

  • Isolate ribosomes by ultracentrifugation (100,000 × g, 16h, 4°C)

  • Extract IF-3 using high-salt wash (1M NH₄Cl) to dissociate factors from ribosomes

  • Concentrate proteins by ammonium sulfate precipitation

  c. Purification:

  • Fractionate proteins using ion exchange chromatography

  • Identify IF-3-containing fractions by Western blotting or activity assays

  • Further purify using size exclusion chromatography

• Comparative analysis techniques:

  • Mass spectrometry to confirm protein identity and detect post-translational modifications

  • Circular dichroism spectroscopy to compare secondary structure profiles

  • Thermal stability analysis using differential scanning fluorimetry

  • Functional comparison using ribosome binding and anti-association assays

  • Kinetic analysis of interaction with 30S subunits using surface plasmon resonance

• Data analysis framework:

  • Establish quantitative metrics for comparing native and recombinant protein properties

  • Use statistical methods such as one-way ANOVA with Benjamini-Hochberg multiple testing correction for rigorous comparison

  • Normalize functional data to account for differences in protein purity and activity

This approach enables researchers to establish whether recombinant IF-3 accurately reflects the properties of the native protein, providing critical validation for subsequent structural and functional studies.