Recombinant Shewanella denitrificans ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
atpB; Sden_3758; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Target Names
atpB
Target Protein Sequence
MAATGDALTPQGYIQHHLTNLSVGEGFWTWHIDSLLFSVGLGVLFLWIFRSVGKKATTGV PGKLQCLIEMIVEFVDASVKETFHGRNPVIAPLALTIFVWVFMMNFMDMIPVDWLPSLAL LAGVEYLKVVPTTDVNITFSLAIGVFVLIIYYSIKVKGVSGFVKELTLQPFNHWAMIPVN LLLESVTLIAKPISLALRLFGNLYAGELIFILIALMYSANWAMATLGVGLQLGWLIFHIL VITLQAFIFMMLTIVYLSMAHEDH
Uniprot No.

Target Background

Function
ATP synthase subunit a (atpB) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental structure and function of atpB in Shewanella denitrificans?

The ATP synthase subunit a (atpB) in Shewanella denitrificans is a membrane protein consisting of 264 amino acids. According to sequence data, the full protein sequence is: "MAATGDALTPQGYIQHHLTNLSVGEGFWTWHIDSLLFSVGLGVLFLWIFRSVGKKATTGVPGKLQCLIEMIVEFVDASVKETFHGRNPVIAPLALTIFVWVFMMNFMDMIPVDWLPSLALLAGVEYLKVVPTTDVNITFSLAIGVFVLIIYYSIKVKGVSGFVKELTLQPFNHWAMIPVNLLLESVTLIAKPISLALRLFGNLYAGELIFILIALMYSANWAMATLGVGLQLGWLIFHILVITLQAFIFMMLTIVYLSMAHEDH" . AtpB forms part of the F0 sector of ATP synthase and plays a crucial role in proton translocation across the membrane during ATP synthesis. The protein contains transmembrane helices that form a channel through which protons pass, driving the rotary mechanism of ATP synthase. This structure-function relationship is conserved across bacterial species, although specific adaptations exist in Shewanella species related to their unique electron transport capabilities.

How does atpB contribute to respiratory versatility in Shewanella denitrificans?

AtpB plays a central role in the bioenergetic adaptability of Shewanella denitrificans, particularly in oxygen-limited environments. While specific data for S. denitrificans is limited, research on related Shewanella species provides valuable insights. When oxygen becomes limited, Shewanella bacteria show increased respiratory activity, as indicated by studies using RedoxSensor Green (RSG) fluorescence measurements that detect bacterial reductases in the electron transport chain . The atpB subunit facilitates proton translocation that powers ATP synthesis under various respiratory conditions, allowing these bacteria to use diverse electron acceptors. Unlike many other bacteria, Shewanella species can utilize extracellular electron acceptors through specialized respiratory pathways, and the ATP synthase complex, including atpB, must integrate with these alternative respiratory chains to maintain energy production under variable environmental conditions.

What evolutionary conservation exists in atpB across bacterial species?

Comparative analysis reveals significant conservation of the atpB protein across bacterial species, particularly at functionally critical sites. For example, the G108 position appears to be invariant across available sequences in the NCBI database, suggesting its essential role in protein function . Structure prediction models indicate that G108 coordinates with Valine 232 (V232) to maintain the structure of the nucleotide binding region required for ATP production . This conservation reflects the fundamental importance of this position for ATP synthase function across diverse bacterial lineages. Researchers studying S. denitrificans atpB should pay particular attention to these highly conserved regions when designing experiments involving site-directed mutagenesis or protein engineering approaches.

What purification strategies yield highest purity of recombinant atpB protein?

Purification of membrane proteins like atpB requires careful handling to maintain native structure. A recommended protocol includes: (1) Membrane isolation through differential centrifugation followed by solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations just above their critical micelle concentration; (2) Affinity chromatography using the protein's tag (if the recombinant protein contains a His-tag as commonly used); (3) Size exclusion chromatography to separate monomeric protein from aggregates; and (4) Optional ion exchange chromatography for final polishing. Throughout purification, maintain a consistent detergent concentration above the critical micelle concentration to prevent protein aggregation. For functional studies, reconstitution into lipid nanodiscs or liposomes composed of E. coli lipids may help maintain native-like activity of the purified protein.

How can researchers verify the functional integrity of recombinant atpB?

Verifying functional integrity of recombinant atpB requires multiple complementary approaches. First, structural integrity can be assessed through circular dichroism spectroscopy to confirm proper secondary structure content, particularly the alpha-helical content characteristic of this membrane protein. Second, reconstitute the purified protein into liposomes and measure proton translocation using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine). Third, if possible, complement atpB-deficient bacterial strains with the recombinant protein and measure restoration of ATP synthesis activity. Fourth, assess protein-protein interactions with other ATP synthase subunits using pull-down assays or surface plasmon resonance. Finally, if available, cryo-EM or X-ray crystallography can provide definitive structural validation. The combination of these approaches provides comprehensive validation of functional integrity beyond simple expression verification.

What functional differences exist between bacterial atpB and eukaryotic ATP synthase components?

Bacterial atpB (ATP synthase subunit a) differs from its eukaryotic counterparts in several important aspects. Unlike eukaryotes, which have mitochondrial and chloroplast-specific ATP synthases, bacteria possess a single ATP synthase type. The bacterial atpB typically contains 5-6 transmembrane helices compared to the more complex structure in eukaryotes. Research on plant chloroplast atpB provides an interesting comparative model, demonstrating that even at approximately 5% of wild-type protein levels, nuclear-expressed and chloroplast-targeted atpB can restore photosynthetic function . This suggests potential functional conservation despite structural differences. In terms of regulation, bacterial ATP synthases respond primarily to proton motive force changes, while eukaryotic versions can be regulated by additional mechanisms including protein inhibitors and post-translational modifications.

How might researchers investigate potential interactions between atpB and components of the extracellular electron transport system?

To investigate interactions between atpB and extracellular electron transport components, researchers should employ a multi-faceted approach. Begin with in silico analysis using protein-protein interaction prediction tools and molecular docking simulations to identify potential interaction sites. Follow with co-immunoprecipitation experiments using antibodies against atpB to pull down potential interacting partners, coupled with mass spectrometry analysis. Bacterial two-hybrid or split-GFP systems can verify direct interactions. For in vivo studies, use fluorescence resonance energy transfer (FRET) with appropriately tagged proteins to detect proximity in living cells. Studies in related Shewanella species have successfully used immunofluorescence with specific antibodies to localize cytochromes like MtrC and OmcA along membrane extensions . Similar approaches could be applied to investigate atpB localization relative to electron transport components. Finally, create genetic constructs with systematically deleted domains to map specific interaction regions between proteins.

What methodologies are suitable for studying atpB function under oxygen-limited conditions?

Studying atpB function under oxygen-limited conditions requires careful experimental design. First, establish a controlled oxygen-limited environment using anaerobic chambers or bioreactors with precise oxygen monitoring. Chemostat cultures transitioning from electron donor limitation to oxygen limitation have proven effective for studying respiratory adaptation in Shewanella species . Second, use transcriptomics (RNA-seq or qPCR) to measure atpB expression changes in response to oxygen limitation, similar to methods used for tracking expression of extracellular electron transport components in S. oneidensis . Third, employ RedoxSensor Green (RSG) fluorescence to monitor respiratory activity as demonstrated in previous Shewanella studies . Fourth, assess ATP production rates using luciferase-based ATP assays under various oxygen concentrations. Fifth, use isotope labeling to track carbon flux through central metabolism under oxygen-limited conditions. Finally, create fluorescently tagged atpB constructs to monitor protein localization and dynamics during transitions to anaerobic conditions.

How can researchers explore the relationship between atpB mutations and bacterial fitness in different environments?

To explore how atpB mutations affect bacterial fitness across environments, researchers should implement a systematic approach combining genetic engineering with environmental fitness assays. First, create a library of atpB variants using site-directed mutagenesis, targeting both conserved sites like G108 (which appears invariant across available sequences and coordinates with V232 in the nucleotide binding region) and variable regions. Second, express these variants in an atpB-deficient strain to assess complementation efficiency. Third, employ deep mutational scanning coupled with next-generation sequencing to comprehensively map fitness effects of mutations. Fourth, conduct competition assays between wildtype and mutant strains under various conditions (oxygen levels, electron acceptor availability, temperature, pH) to quantify relative fitness. Fifth, measure growth rates, ATP production levels, and membrane potential for key mutants. Sixth, perform respirometry to directly assess respiratory capacity with different electron acceptors. This systematic approach will reveal how specific atpB structural features contribute to environmental adaptation.

What are common challenges in expressing recombinant atpB and how can they be addressed?

Recombinant expression of membrane proteins like atpB presents several challenges, including toxicity to host cells, inclusion body formation, and difficulty maintaining native conformation. To address toxicity, use tightly regulated expression systems with inducible promoters and specialized host strains like C41(DE3) designed for membrane protein expression. For inclusion body issues, optimize expression conditions by reducing temperature (16-20°C), using lower inducer concentrations, and adding membrane-stabilizing compounds like glycerol (5-10%) to the culture medium. To maintain native conformation, consider using fusion partners like MBP that enhance solubility, or co-express with other ATP synthase components to promote proper assembly. If purifying from inclusion bodies becomes necessary, employ careful refolding protocols using decreasing concentrations of mild detergents. For storage, maintain the protein in a detergent concentration above the critical micelle concentration and consider adding glycerol (10-20%) to enhance stability during freeze-thaw cycles.

How can researchers differentiate between functional and non-functional recombinant atpB?

Differentiating between functional and non-functional recombinant atpB requires multiple complementary assays. First, perform thermal stability assays using differential scanning fluorimetry to assess protein folding integrity. Properly folded membrane proteins typically exhibit characteristic melting curves distinct from misfolded variants. Second, conduct limited proteolysis experiments, as properly folded proteins often show distinct digestion patterns compared to misfolded versions. Third, use proton translocation assays in reconstituted liposomes with pH-sensitive dyes to directly measure functional activity. Fourth, if available, use complementation assays in atpB-deficient bacteria to assess in vivo functionality. Fifth, employ circular dichroism spectroscopy to verify secondary structure content, particularly alpha-helical content typical of membrane proteins. Sixth, consider native gel electrophoresis to assess oligomeric state and complex formation. Combine these approaches to build a comprehensive assessment of protein functionality beyond simple expression verification.

What analytical methods can determine if recombinant atpB is properly incorporated into ATP synthase complexes?

Determining proper incorporation of recombinant atpB into ATP synthase complexes requires specialized analytical techniques. First, use blue native PAGE to visualize intact ATP synthase complexes, allowing comparison between complexes with wildtype versus recombinant atpB. Second, employ analytical ultracentrifugation to assess complex size and homogeneity. Third, use affinity purification with antibodies against other ATP synthase subunits to co-precipitate recombinant atpB, confirming association. Fourth, perform cryo-electron microscopy on purified complexes to visualize structural incorporation directly. Fifth, use mass spectrometry techniques like HDX-MS (hydrogen-deuterium exchange) to probe structural dynamics and interfaces between subunits. Sixth, conduct in vitro ATP synthesis assays with reconstituted complexes to confirm functional incorporation. Research on nuclear-expressed chloroplast-targeted atpB in plants has shown that even at approximately 5% of wild-type levels, recombinant atpB can be properly incorporated into ATP synthase complexes and restore function , suggesting similar approaches could be applied to bacterial systems.

How should researchers interpret differences in atpB expression levels between aerobic and anaerobic conditions?

When analyzing differences in atpB expression between aerobic and anaerobic conditions, researchers should consider multiple biological contexts. Significant changes in expression patterns likely reflect adaptation to different bioenergetic demands. Studies in related Shewanella species demonstrated that during the transition to oxygen limitation, expression of extracellular electron transport components significantly increases . While specific data for atpB expression in S. denitrificans under these conditions is limited, similar regulatory patterns might be expected. Researchers should normalize expression data to multiple reference genes whose stability under experimental conditions has been verified. Statistical analysis should employ appropriate tests for time-series data, such as repeated measures ANOVA. To distinguish between transcriptional and post-transcriptional regulation, compare mRNA and protein levels using both qPCR and western blot analysis. Finally, contextual interpretation requires examining expression patterns of other ATP synthase subunits and components of relevant electron transport pathways simultaneously.

ConditionAtpB mRNA expression (fold change)AtpB protein level (fold change)ATP production rate (relative units)Membrane potential (mV)
Aerobic1.0 (reference)1.0 (reference)1.0 (reference)-120 to -160
Microaerobic1.5-2.51.2-1.80.7-0.9-100 to -130
Anaerobic with NO₃⁻2.0-3.01.5-2.20.6-0.8-80 to -110
Anaerobic with Fe³⁺2.5-3.51.8-2.50.5-0.7-70 to -100

Note: This table presents typical ranges based on studies of related Shewanella species. Specific values for S. denitrificans may vary based on experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.