Recombinant Shewanella denitrificans Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
rnfE; Sden_1868; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Target Names
Sden_1868
Target Protein Sequence
MSQYQEIAKQGLWHNNPGLVQLLGLCPLLAVTATVTNALGLGFATLLVLVGSNMLVSLVR DYVPKEIRIPVFVMIIAALVTSVQLLINAYAYGLYLSLGIFLPLIVTNCVIIGRAEAFAS RNNLAHSAFDGLMMGIGFTCVLVVLGAGRELLGQGTLFEGADLLLGDWAKALVMQVWQVD TPFLLALLPPGAFIGMGLLIAGKNVIDARLKARQPKTQAEPVARVRITKVS
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex that facilitates the coupling of electron transfer with ion translocation across the membrane.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of the RnfE protein in Shewanella denitrificans?

RnfE is a critical component of the Rnf complex (Rhodobacter nitrogen fixation complex) in Shewanella denitrificans, which functions as an ion-translocating ferredoxin:NAD+ oxidoreductase. In S. denitrificans, one of the few Shewanella strains capable of complete denitrification (reducing NO3− to N2), the Rnf complex plays an essential role in electron transport during anaerobic respiration . The complex creates a transmembrane ion gradient that drives energy conservation during the denitrification process. Unlike many Shewanella species that utilize the Mtr pathway (which is essential for reducing flavins and electrodes in S. oneidensis MR-1) , S. denitrificans employs the Rnf complex as part of its specialized machinery for complete denitrification.

How is recombinant RnfE typically expressed in laboratory settings?

Recombinant RnfE from S. denitrificans is typically expressed using E. coli expression systems with vectors containing T7 or similar strong promoters. The general expression protocol involves:

  • Cloning the rnfE gene from S. denitrificans genomic DNA

  • Inserting the gene into an expression vector with an appropriate tag (His6, GST, etc.)

  • Transforming the construct into an E. coli expression strain (BL21(DE3) or similar)

  • Inducing expression with IPTG (typically 0.5-1.0 mM)

  • Growing cells under microaerobic or anaerobic conditions at lower temperatures (16-25°C) to enhance proper folding

This approach is similar to strategies used for other challenging membrane-associated electron transport proteins from Shewanella species, which often require specialized conditions to maintain protein stability and functionality .

What purification methods are most effective for recombinant RnfE?

Purification of recombinant RnfE requires specialized approaches due to its membrane association. Based on protocols used for similar electron transport proteins in Shewanella species, the following procedure is recommended:

StepMethodBuffer CompositionNotes
1Cell lysis50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM DTT, protease inhibitorsSonication or French press under anaerobic conditions
2Membrane extractionAbove buffer + 1-2% mild detergent (DDM or CHAPS)Gentle stirring for 1-2 hours at 4°C
3Affinity chromatographyAbove buffer + 0.05% detergent, 20-250 mM imidazole gradientFor His-tagged protein
4Size exclusion50 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.02% detergentFinal polishing step

The use of mild detergents is crucial for maintaining RnfE in a functional state, as has been demonstrated with other membrane-associated electron transport proteins from Shewanella species .

How can I determine if recombinant RnfE is properly folded and functional?

Assessing the functional integrity of recombinant RnfE requires multiple complementary approaches:

  • Spectroscopic Analysis: UV-visible absorption spectroscopy to detect characteristic peaks of bound cofactors (similar to analyses performed with other Shewanella electron transport proteins)

  • Electron Transfer Assays: Measure electron transfer between ferredoxin and NAD+ using:

    • Methyl viologen as an artificial electron donor

    • NAD+ as the electron acceptor

    • Rate measurement by monitoring NAD+ reduction at 340 nm

  • Reconstitution Experiments:

    • Incorporation into liposomes

    • Measurement of ion (Na+ or H+) translocation across the membrane

    • Assessment of membrane potential generation using voltage-sensitive dyes

  • Complementation Studies:

    • Expression in S. denitrificans rnfE knockout mutants

    • Restoration of denitrification ability (similar to functional validation studies performed with S. oneidensis lactate dehydrogenase enzymes)

The true functionality of RnfE can only be confirmed when the protein demonstrates both electron transfer activity and the ability to participate in energy conservation during denitrification .

What are the key differences between RnfE in S. denitrificans and similar proteins in other Shewanella species?

While most Shewanella species utilize the Mtr pathway for extracellular electron transfer, S. denitrificans employs a distinct electron transport system featuring the Rnf complex to enable complete denitrification. Key differences include:

FeatureS. denitrificans RnfEOther Shewanella Species
Genomic contextPart of a specialized denitrification gene clusterLack complete denitrification pathways
Primary functionSupports reduction of NO3− to N2Many use Mtr pathway for Fe(III) reduction
Cofactor bindingContains FeS clusters for electron transferCytochrome c-based electron transfer in many species
Electron acceptorsSpecialized for nitrogen oxidesOften versatile, including metals, electrodes
Membrane localizationInner membrane complexOuter membrane cytochromes in many species

S. denitrificans OST5127 is one of only a few Shewanella strains (along with S. amazonensis SB2B and S. loihica PV4) reported to reduce NO3− to N2, employing either the nar or nap clusters for NO3− reduction to NO2−, the nir cluster for NO2− reduction to NO, the nor cluster for NO reduction to N2O, and the nos cluster for N2O reduction to N2 .

How can I optimize recombinant RnfE expression to increase protein yield while maintaining functionality?

Optimizing expression of functional recombinant RnfE requires addressing several challenges specific to membrane-associated electron transport proteins:

  • Expression System Selection:

    • E. coli C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • Consider Shewanella-based expression systems for native-like folding environment

  • Vector Design Optimization:

    • Use of weak promoters (trc or tac instead of T7) to prevent inclusion body formation

    • Codon optimization for the expression host

    • Addition of solubility-enhancing fusion partners (MBP, SUMO)

  • Growth and Induction Conditions:

    • Growth at 18-20°C after induction

    • Use of specialized media supplements:

SupplementConcentrationPurpose
Iron-sulfur cluster precursors (Fe2+, cysteine)50-100 μM FeSO4, 1 mM cysteineEnhance FeS cluster incorporation
Osmolytes (betaine, sorbitol)0.5-1 MStabilize protein folding
Mild inducer concentration0.1-0.3 mM IPTGSlow production, improve folding
  • Anaerobic Expression:

    • Growth under microaerobic or anaerobic conditions

    • Use of sealed flasks with oxygen scavengers or specialized anaerobic chambers

These approaches have proven successful with other challenging electron transport proteins from Shewanella species and can be adapted specifically for RnfE from S. denitrificans.

What are the best methods to study electron flow through RnfE in vitro?

Studying electron flow through RnfE requires specialized techniques that can capture the dynamics of electron transfer:

  • Stopped-Flow Spectroscopy:

    • Rapid mixing of reduced RnfE with electron acceptors

    • Monitoring absorbance changes at characteristic wavelengths

    • Calculation of electron transfer rates under various conditions

  • Protein Film Voltammetry:

    • Immobilization of RnfE on electrode surfaces

    • Direct measurement of electron transfer capabilities

    • Determination of redox potentials of the various cofactors

  • FRET-Based Assays:

    • Labeling of interaction partners with fluorescent probes

    • Real-time monitoring of protein-protein interactions during electron transfer

    • Spatial resolution of electron transfer events

  • EPR Spectroscopy:

    • Characterization of the FeS clusters within RnfE

    • Analysis of changes in cluster oxidation states during catalysis

    • Identification of protein radical intermediates

These techniques have been successfully applied to study electron transport in Shewanella species, particularly in the context of the Mtr pathway , and can be adapted for studying RnfE from S. denitrificans.

How can I resolve expression issues when RnfE forms inclusion bodies?

Inclusion body formation is a common challenge when expressing membrane-associated electron transport proteins like RnfE. To address this issue:

  • Prevention Strategies:

    • Lower induction temperature (16°C)

    • Reduce inducer concentration (0.1 mM IPTG)

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Use specialized expression strains (SHuffle, Origami)

  • Refolding Protocol (if inclusion bodies persist):

StepProcedureBuffer Composition
1Isolation of inclusion bodies50 mM Tris-HCl pH 8.0, 100 mM NaCl, 5 mM EDTA, 0.5% Triton X-100
2Solubilization8 M urea or 6 M guanidine-HCl, 50 mM Tris-HCl pH 8.0, 1 mM DTT
3Refolding by dialysisGradual removal of denaturant in buffer with 0.5-1% detergent, 10% glycerol
4Reconstitution with cofactorsAddition of FeS cluster precursors under anaerobic conditions
  • Alternative Approach - Cell-Free Expression:

    • Use of E. coli extracts supplemented with detergents or nanodiscs

    • Direct synthesis into a membrane-mimetic environment

    • Co-translational incorporation of cofactors

These strategies have been successfully applied to other challenging electron transport proteins and can be adapted specifically for recombinant RnfE .

How can I establish reliable assays to measure RnfE contribution to denitrification?

To quantify the specific contribution of RnfE to the denitrification process:

  • In Vitro Reconstitution Assays:

    • Incorporation of purified RnfE into liposomes

    • Addition of other components of the denitrification pathway

    • Measurement of electron flow rates and coupling to ion translocation

  • Genetic Approaches:

    • Creation of rnfE knockout mutants in S. denitrificans

    • Complementation with wild-type and mutated versions of RnfE

    • Quantification of denitrification rates and intermediates

    • Comparative analysis of different Shewanella strains with varying denitrification capabilities

  • Analytical Methods for Denitrification Measurement:

MethodMeasuresEquipment
Gas chromatographyN2, N2O productionGC with TCD or ECD detector
Ion chromatographyNO3−, NO2− consumptionHPLC with conductivity detector
MicroelectrodesNO, O2 concentrationsClark-type electrodes
Isotope tracer studies15N-labeled intermediatesMass spectrometry
  • Interaction Studies:

    • Co-immunoprecipitation to identify RnfE interaction partners

    • Blue native PAGE to analyze intact Rnf complex formation

    • Cross-linking mass spectrometry to map protein interfaces

These approaches can help establish the mechanistic role of RnfE in the denitrification process of S. denitrificans, similar to how the role of other electron transport proteins has been established in Shewanella species .

What strategies can I use to determine the structure of RnfE and its interactions within the Rnf complex?

Determining the structure of membrane proteins like RnfE presents unique challenges. The following complementary approaches can be employed:

These approaches have been successfully applied to other challenging membrane proteins and electron transport complexes from bacteria, including those from Shewanella species .

How does RnfE-mediated electron transport contribute to interspecies electron transfer in microbial communities?

RnfE in S. denitrificans may play a significant role in interspecies electron transfer within microbial communities:

  • Mechanisms of Interspecies Electron Transfer:

    • Direct electron transfer through physical connections (nanowires, nanotubes)

    • Electron shuttling via soluble mediators (flavins, humic substances)

    • Metabolic cooperation through exchange of intermediate metabolites

  • Role in Microbial Communities:

    • S. denitrificans may enhance denitrification activity within microbial communities through interspecies electron transfer, similar to how S. oneidensis facilitates such processes

    • RnfE likely contributes to energy conservation during these interactions

  • Experimental Approaches to Study Community Interactions:

ApproachMethodologyMeasurable Outcomes
Co-culture experimentsGrowth of S. denitrificans with other denitrifiersEnhanced denitrification rates, gene expression changes
MetatranscriptomicsRNA sequencing of mixed communitiesDifferential expression of rnfE and related genes
Biofilm studiesConfocal microscopy of mixed-species biofilmsSpatial organization, electron transfer zones
Isotope probing13C or 15N labeled substratesTracking of metabolic exchange
  • Enhancement of Community Functions:

    • S. denitrificans with functional RnfE may contribute to more efficient nitrogen cycling in environments where denitrification occurs, such as wastewater treatment plants and lake sediments

    • These interactions may involve membrane vesicles that enhance electron transfer capabilities

Understanding these community interactions has implications for environmental microbiology, bioremediation, and microbial fuel cell technologies .

What are the key differences in electron flow between the Rnf complex in S. denitrificans and the Mtr pathway in other Shewanella species?

The electron flow mechanisms differ significantly between the Rnf complex in S. denitrificans and the well-characterized Mtr pathway in other Shewanella species:

  • Pathway Architecture Comparison:

FeatureRnf Complex (S. denitrificans)Mtr Pathway (S. oneidensis)
LocationInner membraneSpans periplasm to outer membrane
Key componentsRnfABCDEG proteinsMtrCAB, OmcA, CymA proteins
Primary electron carriersFeS clustersc-type cytochromes
Energy conservationNa+ or H+ gradient generationNo direct energy conservation
Terminal electron acceptorsNitrogen oxidesMetal oxides, electrodes, flavins
  • Electron Flow Direction:

    • Rnf complex: Typically bidirectional, can operate in forward or reverse directions

    • Mtr pathway: Primarily unidirectional, moving electrons from the quinone pool to extracellular acceptors

  • Regulation Patterns:

    • Rnf complex: Expression tied to nitrogen availability and redox status

    • Mtr pathway: Regulated by oxygen tension and metal availability

  • Evolutionary Significance:

    • S. denitrificans has evolved specialized machinery for denitrification

    • Most Shewanella species have evolved the Mtr pathway for reduction of metal oxides

This fundamental difference in electron transport machinery explains why S. denitrificans is one of the few Shewanella species capable of complete denitrification, while most other species excel at metal reduction through the Mtr pathway .

How can computational approaches advance our understanding of RnfE function?

Computational methods offer powerful tools for studying RnfE function in S. denitrificans:

  • Molecular Dynamics Simulations:

    • Modeling of RnfE within a lipid bilayer environment

    • Simulation of electron and ion transport processes

    • Identification of conformational changes during catalysis

  • Quantum Mechanical/Molecular Mechanical (QM/MM) Calculations:

    • Detailed modeling of electron transfer reactions at FeS clusters

    • Calculation of energy barriers and reaction rates

    • Prediction of effects of amino acid substitutions

  • Systems Biology Approaches:

    • Genome-scale metabolic modeling of S. denitrificans

    • Flux balance analysis to predict the impact of RnfE on cellular energetics

    • Integration with experimental data to refine models

  • Machine Learning Applications:

    • New AI tools like PINNACLE can help understand how RnfE behaves in its cellular context, capturing protein-protein interactions that influence function

    • Prediction of optimal conditions for protein expression and activity

    • Identification of potential inhibitors or activators

These computational approaches can complement experimental methods and provide insights that may be difficult to obtain through laboratory studies alone .

What mutagenesis strategies can identify critical residues in RnfE for electron transfer?

Systematic mutagenesis can reveal the functional importance of specific RnfE residues:

  • Targeted Approaches:

    • Mutation of conserved cysteine residues involved in FeS cluster binding

    • Alteration of charged residues potentially involved in ion translocation

    • Modification of residues at predicted protein-protein interaction interfaces

  • High-Throughput Strategies:

StrategyMethodologyOutput
Alanine scanningSystematic replacement of regions with alanineIdentification of essential regions
Deep mutational scanningCreation of variant libraries, selection for functionComprehensive fitness landscape
CRISPR-based screeningIn vivo genome editing, phenotype selectionFunctionally important genomic regions
  • Functional Assays for Mutant Characterization:

    • Electron transfer rates using artificial electron donors/acceptors

    • Ion translocation efficiency in reconstituted liposomes

    • Complementation of rnfE knockout phenotypes

  • Structural Interpretation:

    • Mapping of functional residues onto structural models

    • Identification of electron transfer pathways

    • Correlation between conservation and functional importance

This approach has been successfully used to characterize other electron transport proteins in Shewanella species, such as the components of the Mtr pathway .

How might RnfE be engineered for biotechnological applications in bioelectrochemical systems?

The unique electron transport capabilities of RnfE could be harnessed for various biotechnological applications:

  • Bioelectrochemical Systems:

    • Engineering RnfE to enhance electron transfer to electrodes

    • Development of S. denitrificans-based biocathodes for denitrification

    • Integration into microbial fuel cells for electricity generation

  • Bioremediation Applications:

    • Enhancement of nitrate removal from contaminated groundwater

    • Development of engineered S. denitrificans strains with improved denitrification kinetics

    • Creation of immobilized cell systems for wastewater treatment

  • Protein Engineering Strategies:

ApproachMethodPotential Outcome
Directed evolutionSelection for improved electron transferRnfE variants with enhanced activity
Domain swappingFusion with components from Mtr pathwayHybrid proteins with novel capabilities
Cofactor engineeringModification of FeS cluster binding sitesAltered redox potentials
  • Synthetic Biology Applications:

    • Creation of artificial electron transport chains

    • Design of bacteria with modular redox capabilities

    • Development of biosensors for nitrogen oxides

These applications could benefit from understanding how Shewanella species like S. oneidensis utilize flavins as electron shuttles and form biofilms on electrode surfaces, mechanisms that could potentially be engineered into S. denitrificans with functional RnfE .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.