Recombinant Shewanella denitrificans Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MsbA is a homodimeric ABC transporter conserved across Gram-negative bacteria. In Shewanella denitrificans, the recombinant msbA protein retains the functional domains necessary for lipid A flipping:

  • Nucleotide-binding domains (NBDs): Bind and hydrolyze ATP to drive transport .

  • Transmembrane domains (TMDs): Form a hydrophilic chamber for lipid A passage .

  • Substrate-binding cleft: Accommodates lipid A and other amphipathic molecules .

Recombinant production in Escherichia coli ensures high yields (~90% purity) while preserving ATPase activity comparable to native forms .

Table 1: Expression and Purification Details

ParameterCreative Biomart Cusabio
UniProt IDQ0HTS8Q12M46
Expression HostE. coliE. coli
TagN-terminal HisNot specified
Protein Length601 residues (Full-length)Partial sequence provided
Purity>90% (SDS-PAGE)Not specified
Storage-20°C/-80°C in Tris/PBS + 6% trehalose-20°C/-80°C

Table 2: Functional Characteristics

PropertyDescription
ATPase Activity6–10 μmol ATP/min/mg (similar to lipid nanodisc-reconstituted MsbA)
Substrate SpecificityTranslocates lipid A, phospholipids, and glycolipids
InhibitionSuppressed by lipid A and quinoline-based antibiotics

Antibiotic Development

MsbA is a validated target for novel antibiotics due to its essential role in membrane integrity . Quinoline inhibitors (e.g., G592, G913) selectively block E. coli MsbA ATPase activity (EC₅₀ = 0.5–2 μM) . Resistance mutations (e.g., A175V, P176L) map to the inhibitor-binding pocket, confirming target specificity .

Mechanistic Studies

  • Electron paramagnetic resonance (EPR): Tracks ATP hydrolysis-driven conformational changes in the TMD chamber .

  • Fluorescent lipid analogs: Measure flippase activity (e.g., 7.7 nmol NBD-PE translocated/mg protein/20 min) .

Sequence and Mutational Analysis

The full-length S. denitrificans MsbA (601 residues) shares 65% identity with E. coli MsbA. Critical residues include:

  • ATP-binding motifs: Walker A (GXXGXGKST) and Walker B (ΦΦΦΦD, where Φ = hydrophobic) .

  • Dysfunctional mutants: E506Q and H537A abolish ATP hydrolysis but retain ATP binding, stabilizing a closed NBD conformation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the protein with your specified tag.
Synonyms
msbA; Sden_2199; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-600
Protein Length
full length protein
Species
Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Target Names
msbA
Target Protein Sequence
MTASPKNEMSTVFKRLMTYVMPMKGMLTLSILGLIVYGLVDAAFIAFIKPFIDEGFSQNP TVVAGVELPTSGGFSANKDVMLMAPLVVIGMFTLRGVANFVSTYCISYLSAQLIMDMRQQ VFEHYLRLPVSYIDRENSGNLISRVTFDTEQIARASGSALISIVRDSITVIGMLALMFFY SWKLSLCILVIGPLMGVVISIVSKRFRKVSVQIQSAMGGVTATTEQMIKGHKNVLSFGGQ ETESKRFYEVNDRNRYQNMKLAMAQSVSQPVIMIIGSFALAFVLYAASLDSMKLELTAGT FAAILGAMLAMLQPIKNLTRVNAEFQRGIAACTTVFELLDTLPESDTGAHQVERVQGHLR FDNVSFSYPGQAKPALNNIDFDVKPGKTVALVGRSGSGKSTMASLITRFYTGLEQGDIRL DDVSIYDYSLKSLRSQVALVSQQVTLFNDSIANNIAYAYPGEVSREQILKAATLAHAMEF IEQLPEGLDTQVGENGVLLSGGQRQRIAIARAMLRDAPVLILDEATSALDTESEKAIQLG LDNLRHNRTSIVIAHRLSTIESADEILVIDQGKIIERGTHASLIEKKGAYAGLYQMQFGE
Uniprot No.

Target Background

Function
MsbA plays a crucial role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Shewanella denitrificans MsbA protein?

Shewanella denitrificans MsbA belongs to the ATP-binding cassette (ABC) transporter family. Based on homology with other bacterial MsbA proteins, it likely consists of transmembrane domains that form a portal within the membrane and nucleotide-binding domains (NBDs) responsible for ATP hydrolysis. The protein functions as a lipid flippase, transporting lipid A from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane .

The full-length protein is expected to be similar to other Shewanella species MsbA proteins, which comprise 601 amino acids. When expressed recombinantly, it is typically fused to an N-terminal His tag to facilitate purification . The protein adopts multiple conformations during its transport cycle, including inward-facing and outward-facing states that enable substrate capture and release.

How does MsbA function in the bacterial cell membrane?

MsbA is an essential component of the lipopolysaccharide (LPS) transport pathway in gram-negative bacteria like Shewanella denitrificans. The protein functions as an energy-dependent flippase that transports lipid A, with or without core sugars, across the inner membrane . This transport is critical for the assembly of the bacterial outer membrane.

The mechanism involves a "trap and flip" model where lipid A enters through a transmembrane portal when MsbA is in an inward-facing conformation. ATP binding induces conformational changes that close the cytoplasmic side and open the periplasmic side, effectively flipping the lipid substrate across the membrane . X-ray crystallography data from homologous proteins show that MsbA displays large amplitude opening in the transmembrane portal to accommodate the bulky lipid A molecule .

What is known about the relationship between MsbA function and Shewanella denitrificans ecology?

Shewanella denitrificans is a denitrifying estuarine bacterium isolated from the oxic-anoxic interface of the Baltic Sea . The organism is a mesophilic, facultatively anaerobic bacterium capable of using nitrate, nitrite, and sulfite as electron acceptors . The proper functioning of MsbA is likely critical for S. denitrificans to maintain membrane integrity under the variable salinity conditions (0-6%) it encounters in its natural habitat, with optimal growth occurring between 1-3% salinity .

The presence of functional MsbA would enable appropriate lipid A distribution in the membrane, which is essential for bacterial survival in challenging environments. The denitrification capacity of S. denitrificans suggests specialized membrane adaptations that may be reflected in the specific properties of its MsbA protein, potentially distinguishing it from MsbA in non-denitrifying bacteria.

What expression systems are most effective for producing recombinant S. denitrificans MsbA?

The most effective expression system documented for Shewanella MsbA proteins is Escherichia coli . For optimal expression of functional S. denitrificans MsbA, researchers should consider the following methodological approaches:

  • Expression vector selection: Vectors containing strong, inducible promoters (such as T7) with N-terminal His-tag fusion for purification purposes.

  • E. coli strain optimization: BL21(DE3) or C41(DE3) strains are preferred for membrane protein expression.

  • Induction conditions:

    • Temperature: 16-20°C for overnight expression minimizes inclusion body formation

    • IPTG concentration: 0.1-0.5 mM typically provides balanced expression

    • OD600 at induction: 0.6-0.8 for optimal cell density

  • Media supplementation: Addition of 5-10% glycerol can improve membrane protein folding and stability.

Researchers should validate expression through Western blot analysis using anti-His antibodies to confirm the presence of the full-length 601 amino acid protein with the expected molecular weight .

What are the critical steps in purifying recombinant S. denitrificans MsbA while maintaining its functional integrity?

Purification of functional S. denitrificans MsbA requires careful handling to maintain the native structure of this membrane protein:

  • Cell lysis and membrane isolation:

    • Gentle lysis using French press or sonication in buffer containing protease inhibitors

    • Sequential centrifugation to isolate membrane fractions (10,000×g to remove debris, 100,000×g to pellet membranes)

  • Detergent solubilization:

    • Critical step: Selection of appropriate detergent (n-dodecyl-β-D-maltopyranoside or lauryl maltose neopentyl glycol)

    • Solubilization at 4°C with gentle agitation for 1-2 hours

  • Affinity chromatography:

    • Immobilized metal affinity chromatography using the N-terminal His-tag

    • Inclusion of 10-20% glycerol in all buffers to enhance stability

    • Gradual imidazole gradient for elution to separate non-specific binding proteins

  • Final purification:

    • Size exclusion chromatography to isolate monodisperse protein

    • Buffer exchange to remove imidazole

  • Storage considerations:

    • Avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • For long-term storage, add 30-50% glycerol and store at -20°C/-80°C

Quality assessment should include SDS-PAGE to confirm >90% purity and functional assays to verify ATP hydrolysis activity.

How can researchers troubleshoot poor expression or instability issues with recombinant S. denitrificans MsbA?

When encountering expression or stability challenges with S. denitrificans MsbA, consider these methodological solutions:

IssuePotential CauseTroubleshooting Approach
Low expression levelProtein toxicity to hostUse C41/C43(DE3) strains designed for toxic proteins
Codon biasSupplement rare codons or use codon-optimized synthetic gene
Improper induction timingOptimize cell density at induction (OD600 0.4-0.8)
Inclusion body formationRapid overexpressionReduce induction temperature to 16°C
Lower IPTG concentration (0.1 mM)
Add chemical chaperones (e.g., 5% glycerol, 1M sorbitol)
Protein degradationProtease activityInclude multiple protease inhibitors in all buffers
Use protease-deficient host strains
Aggregation during purificationDetergent incompatibilityScreen multiple detergents at various concentrations
Removal of stabilizing lipidsAdd E. coli lipid extract (0.1-0.5 mg/ml) to purification buffers
Loss of activityDestabilizing conditionsMaintain pH between 7.0-8.0 throughout purification
Include 10-20% glycerol in storage buffer
Metal contaminationAdd 1-5 mM EDTA to remove divalent metals

When reconstituting lyophilized protein, follow specific protocols: centrifuge the vial before opening, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, and add 5-50% glycerol for stability during storage .

What assays are most appropriate for measuring the ATPase activity of S. denitrificans MsbA?

Several complementary approaches can be employed to characterize the ATPase activity of S. denitrificans MsbA:

  • Colorimetric phosphate release assays:

    • Malachite green assay: Quantifies inorganic phosphate released during ATP hydrolysis

    • NADH-coupled enzymatic assay: Measures ADP production via pyruvate kinase and lactate dehydrogenase coupling

  • Methodology for optimal results:

    • Buffer composition: 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5 mM MgCl₂, 10% glycerol, appropriate detergent

    • ATP concentration range: 0.1-5 mM for Km determination

    • Temperature: 25-37°C (typically 30°C for mesophilic S. denitrificans proteins)

    • Reaction time: 15-30 minutes in linear range of enzyme activity

  • Data analysis approach:

    • Generate Michaelis-Menten plots to determine Km and Vmax

    • Compare basal vs. lipid A-stimulated activity

    • Analyze inhibition profiles with known ABC transporter inhibitors

  • Controls and validation:

    • Negative control: Heat-inactivated enzyme

    • Positive control: Known functional ABC transporter

    • Validation: ATPase-deficient mutant (e.g., Walker A lysine mutant)

These assays should be performed with purified protein in both detergent-solubilized state and reconstituted proteoliposomes to assess the influence of the lipid environment on enzymatic activity.

How can researchers assess the lipid A flipping activity of S. denitrificans MsbA?

Measuring the transmembrane flipping of lipid A requires specialized approaches that simulate the natural membrane environment:

  • Reconstitution in proteoliposomes:

    • Preparation of unilamellar vesicles with E. coli polar lipids

    • Incorporation of purified MsbA at protein:lipid ratio of 1:200-1:500

    • Verification of orientation using protease accessibility assays

  • Fluorescent lipid A analogs:

    • Synthesis of NBD or BODIPY-labeled lipid A

    • Loading of labeled substrate in inner leaflet

    • Monitoring fluorescence changes upon translocation

  • Real-time flipping assay:

    • Addition of ATP to initiate transport

    • Measurement of fluorescence quenching by membrane-impermeant agents (e.g., sodium dithionite)

    • Calculation of transport rates based on fluorescence kinetics

  • Advanced structural approaches:

    • Co-crystallization with lipid A to identify binding sites as observed in S. typhimurium MsbA

    • Identification of putative lipid A density inside transmembrane cavity and at periplasmic cleft

    • Cryo-electron microscopy to capture multiple conformational states during transport cycle

When interpreting results, researchers should consider that MsbA displays a "trap and flip" mechanism where lipid A enters through the transmembrane portal in an inward-facing conformation before being transported to the periplasmic leaflet .

What are effective experimental designs for studying the substrate specificity of S. denitrificans MsbA?

Understanding the substrate preferences of S. denitrificans MsbA requires systematic approaches comparing various lipid substrates:

  • Competition binding assays:

    • Radiolabeled or fluorescently-labeled lipid A as primary substrate

    • Titration with increasing concentrations of unlabeled potential substrates

    • Determination of IC50 values to rank binding affinities

  • Transport assays with modified substrates:

    • Lipid A variants with altered acylation patterns

    • Truncated lipid A precursors (lipid IVA, etc.)

    • Non-lipid A phospholipids and glycolipids

  • Structure-activity relationship analysis:

    • Systematic modification of lipid A structure:

      • Varying acyl chain length and number

      • Phosphorylation state alterations

      • Core oligosaccharide modifications

    • Correlation of structural features with transport efficiency

  • Site-directed mutagenesis of binding pocket:

    • Identification of key residues in transmembrane cavity based on homology with S. typhimurium MsbA

    • Mutation of predicted substrate-interacting residues

    • Functional assessment of mutants for altered substrate specificity

  • In vivo complementation studies:

    • Expression of S. denitrificans MsbA in conditional MsbA-depleted E. coli

    • Analysis of accumulated lipid substrates by mass spectrometry

    • Assessment of bacterial viability and membrane composition

These approaches should be integrated to develop a comprehensive profile of the substrate selectivity of S. denitrificans MsbA compared to homologs from other bacterial species.

What are the most effective approaches for elucidating the 3D structure of S. denitrificans MsbA?

Determining the three-dimensional structure of S. denitrificans MsbA requires multiple complementary approaches:

  • X-ray crystallography:

    • Crystallization strategies:

      • Lipidic cubic phase for membrane proteins

      • Co-crystallization with lipid A substrate

      • Use of stabilizing facial amphiphiles to promote crystal contacts

    • Resolution enhancement:

      • Screening multiple detergents and precipitants

      • Surface entropy reduction mutations

      • Use of antibody fragments for stabilization

  • Cryo-electron microscopy:

    • Sample preparation:

      • Vitrification in thin ice layers

      • Use of nanodiscs or amphipols to maintain native-like environment

    • Data collection and processing:

      • High-resolution imaging (300 kV microscope)

      • Classification to separate conformational states

      • 3D reconstruction to resolutions <4 Å

  • Integrative structural biology approaches:

    • Small-angle X-ray scattering (SAXS) for solution conformation

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Electron paramagnetic resonance for distance measurements between domains

    • Molecular dynamics simulations to model conformational transitions

When analyzing structural data, researchers should look for key features observed in other MsbA structures, including the large amplitude opening in the transmembrane portal required for lipid A entry and the binding sites within the transmembrane cavity and at the periplasmic cleft .

How do conformational changes in S. denitrificans MsbA facilitate the transport cycle?

S. denitrificans MsbA likely undergoes a series of conformational changes similar to those observed in MsbA from other bacterial species:

  • Key conformational states in the transport cycle:

    • Inward-facing conformation: Open to cytoplasmic side for substrate uptake

    • Intermediate conformations: Progressive closure of cytoplasmic side

    • Outward-facing conformation: Open to periplasmic side for substrate release

  • Nucleotide-dependent conformational changes:

    • Apo state: Wide separation between nucleotide-binding domains (NBDs)

    • ATP-bound state: NBD dimerization driving transmembrane domain rearrangement

    • ADP-bound state: Relaxation back toward inward-facing conformation

  • Substrate-induced effects:

    • Lipid A binding stabilizes specific conformational states

    • Putative lipid A density observed inside transmembrane cavity in crystal structures

    • Additional lipid A binding site at periplasmic cleft potentially representing post-transport state

  • Conformational coupling mechanisms:

    • Transmission of ATP binding/hydrolysis energy to transmembrane domains

    • Alternating access model where substrate-binding site is never simultaneously accessible from both sides

    • Potential "trap and flip" mechanism where large substrate enters cavity before being transported

Researchers should design experiments to capture these conformational states, for example by using ATP analogs (AMP-PNP, ATP-γ-S) to trap intermediate states or by introducing disulfide crosslinks to restrict conformational flexibility.

What structural features distinguish S. denitrificans MsbA from other bacterial MsbA homologs?

While specific structural data for S. denitrificans MsbA is currently limited, comparative analysis with other bacterial MsbA proteins can reveal potential distinguishing features:

  • Transmembrane domain variations:

    • Potential adaptations in the substrate-binding pocket to accommodate specific lipid A structures in S. denitrificans

    • Variations in the size and electrostatic properties of the transport pathway

    • Differences in the periplasmic loops that may influence substrate release

  • Nucleotide-binding domain characteristics:

    • Conservation of Walker A/B motifs and signature sequences required for ATP binding and hydrolysis

    • Potential differences in interdomain communication pathways

    • Species-specific variations in NBD-TMD interfaces affecting conformational coupling

  • Environmental adaptations:

    • Potential structural features reflecting adaptation to the estuarine environment of S. denitrificans

    • Adaptations for function at varying salinity (0-6%) experienced by S. denitrificans

    • Modifications supporting growth at optimal salinity of 1-3%

  • Comparative structural analysis approach:

    • Homology modeling based on S. typhimurium MsbA crystal structure (2.8 Å resolution)

    • Molecular dynamics simulations to identify stable conformational states

    • Sequence conservation analysis focusing on residues lining the transport pathway

Understanding these distinguishing features could provide insights into how MsbA has evolved to support the specific physiological needs of different bacterial species, including the denitrification capacity of S. denitrificans .

How can genetic manipulation of S. denitrificans MsbA advance our understanding of bacterial membrane biogenesis?

Genetic engineering approaches targeting S. denitrificans MsbA can provide valuable insights into bacterial membrane assembly:

  • Site-directed mutagenesis strategies:

    • Walker A/B motif mutations to disrupt ATP binding/hydrolysis

    • Transmembrane domain mutations to alter substrate specificity

    • Introduction of cysteine pairs for disulfide crosslinking to trap specific conformations

    • Reporter fusions for localization and expression studies

  • Conditional expression systems:

    • Development of inducible/repressible MsbA expression in S. denitrificans

    • Analysis of membrane composition changes during MsbA depletion

    • Identification of compensatory mechanisms during limited MsbA function

  • Heterologous expression studies:

    • Complementation of E. coli MsbA-deficient strains with S. denitrificans MsbA

    • Creation of chimeric proteins combining domains from different bacterial MsbA proteins

    • Expression of S. denitrificans MsbA in diverse bacterial species to assess functional conservation

  • In vivo assays:

    • Fluorescent lipid probes to track membrane asymmetry

    • Electron microscopy to visualize membrane ultrastructure changes

    • Lipidomics profiling to detect altered lipid A distribution

These approaches will help establish the direct relationship between MsbA function and the unique membrane characteristics required for S. denitrificans' adaptation to its estuarine environment and denitrification capabilities .

What insights can S. denitrificans MsbA provide for developing novel antimicrobial strategies?

S. denitrificans MsbA research can inform antimicrobial development through several approaches:

  • Structure-based drug design:

    • Identification of druggable pockets in the MsbA structure

    • Virtual screening for compounds that inhibit:

      • ATP binding/hydrolysis

      • Lipid A binding

      • Conformational transitions required for transport

    • Design of lipid A analogs that competitively inhibit transport

  • Inhibition mechanism studies:

    • Characterization of how inhibitors affect:

      • ATPase activity

      • Lipid A binding

      • Conformational changes

      • Membrane permeability and bacterial viability

  • Comparative inhibition profiles:

    • Assessment of inhibitor efficacy against MsbA from:

      • Pathogenic bacteria

      • S. denitrificans

      • Other environmental Shewanella species

    • Identification of species-specific vulnerabilities

  • Target validation approaches:

    • Correlation between MsbA inhibition and bacterial killing

    • Resistance development studies

    • Synergy with existing antibiotics targeting other aspects of cell envelope biogenesis

The essential nature of MsbA for gram-negative bacterial viability makes it an attractive target for antibacterial development . Insights from S. denitrificans MsbA could be particularly valuable for developing antimicrobials effective against denitrifying pathogens that share environmental niches with Shewanella species.

How can computational approaches enhance our understanding of S. denitrificans MsbA transport mechanisms?

Advanced computational methods can provide unique insights into the dynamic function of S. denitrificans MsbA:

  • Molecular dynamics simulations:

    • All-atom simulations in explicit membrane environments

    • Analysis of:

      • Lipid A binding pathways

      • Conformational transition energetics

      • Water and ion permeation

      • ATP hydrolysis coupling to conformational changes

    • Timescales: Microsecond-scale simulations to capture complete transport events

  • Machine learning applications:

    • Prediction of:

      • Substrate specificity based on sequence features

      • Functional effects of mutations

      • Inhibitor binding affinities

    • Training on experimental data from multiple ABC transporters

  • Network analysis approaches:

    • Identification of allosteric communication pathways

    • Community detection algorithms to identify functionally coupled residue clusters

    • Correlation of evolutionary conservation with functional importance

  • Multiscale modeling:

    • Quantum mechanics/molecular mechanics for ATP hydrolysis mechanism

    • Coarse-grained models for longer timescale events

    • Systems biology integration with whole-cell models

These computational approaches should be integrated with experimental validation, particularly focusing on the unique properties of S. denitrificans as a denitrifying estuarine bacterium adapted to variable salinity conditions .

How does S. denitrificans MsbA compare functionally with homologs from other Shewanella species?

A comparative analysis of MsbA across Shewanella species reveals insights into adaptation and function:

  • Sequence and structural comparison:

    • S. denitrificans MsbA likely shares significant homology with other Shewanella MsbA proteins

    • Sequence analysis would reveal conservation in:

      • ATP-binding cassettes (Walker A/B motifs)

      • Transmembrane helices forming the lipid A binding pocket

      • Interface regions between domains

  • Functional differences reflecting ecological niches:

    • S. denitrificans: Adapted for denitrifying conditions in estuarine environments (0-6% salinity)

    • S. amazonensis: Adapted to freshwater environments

    • S. frigidimarina: Adapted to cold marine environments

    • S. baltica: Adapted to Baltic Sea conditions (similar to S. denitrificans)

  • Substrate specificity variations:

    • Potential differences in lipid A structure across Shewanella species

    • Corresponding adaptations in the MsbA binding pocket

    • Varying affinities for lipid A versus other lipid substrates

  • Methodological approach for comparison:

    • Heterologous expression of different Shewanella MsbA proteins

    • Substrate transport assays under identical conditions

    • Complementation studies in MsbA-deficient strains

    • Structural comparison through homology modeling

Understanding these comparative aspects provides insights into how MsbA has evolved to support the diverse ecological adaptations within the Shewanella genus.

What evolutionary insights can be gained from studying S. denitrificans MsbA?

Evolutionary analysis of S. denitrificans MsbA can reveal important aspects of bacterial adaptation and protein evolution:

  • Phylogenetic analysis:

    • Placement of S. denitrificans MsbA within the broader context of:

      • Gamma-proteobacterial ABC transporters

      • MsbA homologs across bacterial phyla

      • Related eukaryotic ABC transporters

    • Identification of evolutionary pressure points through selection analysis

  • Structure-function co-evolution:

    • Correlation between MsbA sequence changes and:

      • Lipid A structural variations across species

      • Environmental adaptations (temperature, salinity, pH)

      • Membrane composition differences

  • Gene duplication and specialization:

    • Analysis of potential MsbA paralogs in S. denitrificans genome

    • Comparative analysis with multi-drug resistance ABC transporters

    • Assessment of functional divergence after duplication events

  • Horizontal gene transfer assessment:

    • Evaluation of MsbA gene neighborhood conservation

    • Detection of atypical sequence characteristics suggesting horizontal acquisition

    • Comparison with MsbA from phylogenetically distant bacteria sharing similar environments

These evolutionary perspectives can provide insights into how essential membrane transport functions are maintained while allowing adaptation to specific environmental conditions, such as the denitrifying capacity that distinguishes S. denitrificans .

How do environmental factors influence the expression and function of S. denitrificans MsbA?

S. denitrificans inhabits variable environments that likely influence MsbA expression and function:

  • Oxygen availability effects:

    • Regulation of MsbA expression under:

      • Oxic conditions

      • Anoxic conditions with alternative electron acceptors (nitrate, nitrite)

      • Transition between oxic-anoxic interfaces (natural habitat)

    • Potential coupling between denitrification pathways and membrane lipid transport

  • Salinity adaptation mechanisms:

    • S. denitrificans grows in 0-6% salinity, optimally at 1-3%

    • Potential salinity-dependent regulation of:

      • MsbA expression levels

      • Lipid A structural modifications

      • MsbA transport kinetics and substrate specificity

  • Temperature-dependent effects:

    • Mesophilic growth characteristics of S. denitrificans

    • Membrane fluidity adaptations requiring modified lipid transport

    • Temperature effects on MsbA conformational dynamics

  • Experimental approaches:

    • Transcriptomic and proteomic profiling under varying conditions

    • Reporter gene fusions to monitor in vivo expression

    • In vitro functional assays simulating different environmental conditions

    • Membrane composition analysis correlating with MsbA expression

Understanding these environmental influences provides insights into how S. denitrificans maintains appropriate membrane composition and function across the variable conditions of its estuarine habitat, particularly at the oxic-anoxic interfaces where it was originally isolated .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.