Recombinant Shewanella denitrificans Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; Sden_1156; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Target Names
mtgA
Target Protein Sequence
MTVRRRGFMAWTWFITWRFLLVVVLLLLVLLLVLRFVPPPTTSFMLQSAYPVSQHWVSID ELPSHLPLAVVASEDQLFPKHFGIDFTSITKALNQYDDGQGLRGASTITQQTAKNLLLWP GRNLVRKGLEAMLAVSLEAVWGKKRILEVYLNVAEFGKGIYGVEAASRHYFNKSARYLSI NEAARLAVLLPSPRSRSPHHLTPYLHQRVAWGEKQMRQLGSGYLKTILN
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the taxonomic classification of Shewanella denitrificans and how does it influence mtgA research?

Shewanella denitrificans is classified within the gamma-Proteobacteria, specifically in the genus Shewanella. Phylogenetic analyses based on 16S rDNA sequences show closest sequence similarity (95-96%) with Shewanella baltica, Shewanella putrefaciens, and Shewanella frigidimarina . This taxonomic position is significant for mtgA research as different Shewanella species may exhibit variations in peptidoglycan structure and enzyme function.

The species was originally isolated from the oxic-anoxic interface of an anoxic basin in the central Baltic Sea, with the type strain designated as OS217(T) (= DSM 15013(T) = LMG 21692(T)) . S. denitrificans demonstrates distinctive physiological characteristics including being unpigmented, polarly flagellated, mesophilic, and facultatively anaerobic with the ability to use nitrate, nitrite, and sulphite as electron acceptors . These characteristics create unique environmental adaptations that may influence the function and structure of cellular components including peptidoglycan and associated enzymes like mtgA.

How does the growth environment affect the expression and activity of mtgA in S. denitrificans?

S. denitrificans exhibits growth at salinities ranging from 0% to 6%, with optimal growth occurring between 1% and 3% . When designing expression systems for recombinant mtgA, researchers should consider these salinity parameters to maximize protein yield and activity.

Methodologically, growth experiments should include:

  • Assessment of mtgA expression levels across different salinity conditions (0-6%)

  • Monitoring enzyme activity in relation to growth phase

  • Evaluation of oxygen levels, as S. denitrificans is facultatively anaerobic

  • Testing of nitrate/nitrite concentrations, which may affect cell wall synthesis pathways

The denitrification capacity of S. denitrificans may cause pH shifts in culture media, potentially affecting protein folding and enzyme activity. Therefore, buffer systems should be carefully selected when designing expression protocols for recombinant mtgA production.

What are the structural characteristics of S. denitrificans mtgA compared to other bacterial transglycosylases?

The monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) from S. denitrificans likely shares conserved domains with other bacterial transglycosylases while potentially exhibiting unique features related to its marine bacterial origin. Transglycosylases catalyze the polymerization of lipid II to form glycan strands in peptidoglycan synthesis.

Key structural considerations include:

  • Conserved catalytic domain with potential adaptations to function in variable salinity environments

  • Membrane association domains that may be influenced by the fatty acid composition of S. denitrificans (dominant fatty acids include 16:1omega7c, 15:0 iso, 16:0, and 13:0 iso)

  • Potential structural adaptations related to the G+C content of S. denitrificans DNA (46.8-48.1 mol%)

For comprehensive structural characterization, researchers should employ multiple approaches including X-ray crystallography, circular dichroism spectroscopy, and homology modeling based on related transglycosylases with known structures.

What are the optimal conditions for expressing recombinant S. denitrificans mtgA in heterologous systems?

When expressing recombinant S. denitrificans mtgA, researchers should consider:

Expression System Selection:

  • E. coli-based systems with codon optimization accounting for the lower G+C content (46.8-48.1 mol%) of S. denitrificans

  • Alternative expression hosts such as other Shewanella species for improved folding and activity

  • Cell-free expression systems for potentially toxic membrane-associated proteins

Optimization Parameters:

  • Temperature: Consider mesophilic nature of S. denitrificans

  • Induction timing: Align with growth phases observed in natural S. denitrificans cultures

  • Salt concentration: Test range from 1-3% NaCl to mimic optimal growth conditions

Solubilization Strategies:

  • Fusion tags selection (His, GST, MBP) based on downstream applications

  • Detergent screening for membrane-associated portions of mtgA

  • Inclusion body recovery and refolding protocols if necessary

Researchers should implement a Design of Experiments (DoE) approach to systematically identify optimal expression conditions across multiple variables simultaneously, rather than testing single variables in isolation.

What assay systems effectively measure the transglycosylase activity of recombinant S. denitrificans mtgA?

In Vitro Enzymatic Assays:

  • Fluorescence-based assays using dansylated or fluorescein-labeled lipid II substrates

  • HPLC-based detection of polymerized glycan products

  • Mass spectrometry for detailed product characterization

  • Radioactive assays using [14C]-labeled substrates for higher sensitivity

Experimental Controls:

  • Heat-inactivated enzyme preparations

  • Known transglycosylase inhibitors (moenomycin, vancomycin)

  • Comparison with characterized mtgA enzymes from related species

Data Analysis Approach:

  • Michaelis-Menten kinetic analysis for determining Km and Vmax values

  • Evaluation of substrate specificity across different lipid II variants

  • Assessment of pH and salt concentration effects on enzyme activity

Notably, the facultatively anaerobic nature of S. denitrificans suggests that oxygen conditions should be controlled and varied within assay systems to determine optimal activity conditions.

How can researchers effectively purify recombinant mtgA while maintaining its structural integrity and activity?

Purification of recombinant S. denitrificans mtgA presents challenges due to potential membrane association and complex folding requirements. A comprehensive purification strategy should include:

Initial Extraction Methods:

  • Differential detergent screening (ionic, non-ionic, and zwitterionic)

  • Cell disruption optimization (sonication, French press, enzymatic lysis)

  • Buffer composition tailored to S. denitrificans osmotic preferences (1-3% salt)

Chromatography Sequence:

  • Affinity chromatography (Ni-NTA for His-tagged constructs)

  • Ion exchange chromatography (considering theoretical pI of mtgA)

  • Size exclusion chromatography for final polishing and oligomer analysis

Activity Preservation Measures:

  • Addition of glycerol (10-20%) to maintain protein stability

  • Testing of salt requirements for structural integrity

  • Potential inclusion of lipid nanodiscs for membrane-associated portions

Quality Control Metrics:

  • SDS-PAGE with Western blotting for purity assessment

  • Activity assays at each purification step to track specific activity

  • Circular dichroism to confirm secondary structure integrity

  • Dynamic light scattering for aggregation monitoring

How does the denitrification capacity of S. denitrificans influence the function and regulation of mtgA?

S. denitrificans is characterized by its vigorous denitrification capacity, utilizing nitrate, nitrite, and sulfite as electron acceptors . This metabolic capability likely influences cell wall synthesis and mtgA function through several mechanisms:

Redox-Dependent Regulation:

  • Potential regulatory mechanisms linking electron transport chain status to cell wall synthesis

  • Examination of mtgA activity under various redox conditions

  • Identification of potential redox-sensitive residues within the mtgA structure

Metabolic Integration:

  • Investigation of how energy conservation during denitrification affects peptidoglycan synthesis

  • Analysis of the relationship between nitrogen metabolism and cell wall precursor availability

  • Measurement of mtgA expression levels during shifts between aerobic and anaerobic growth

Experimental Approach:

  • Construct reporter gene fusions to monitor mtgA expression under different electron acceptor conditions

  • Compare peptidoglycan composition when grown with different electron acceptors

  • Utilize metabolic flux analysis to track precursor allocation during aerobic vs. anaerobic growth

This research direction provides insight into how fundamental metabolic adaptations in S. denitrificans may have shaped specialized functions of its cell wall synthesis machinery.

What are the catalytic mechanisms and substrate specificity determinants of S. denitrificans mtgA?

Understanding the detailed catalytic mechanism of S. denitrificans mtgA requires comprehensive biochemical and structural studies:

Active Site Analysis:

  • Site-directed mutagenesis of predicted catalytic residues

  • Inhibitor binding studies with various transglycosylase inhibitors

  • Computational docking of substrate analogs

Substrate Specificity Investigation:

  • Synthesis and testing of lipid II variants with modifications in:

    • Peptide stem composition

    • Glycan moieties

    • Lipid tail length and saturation

Kinetic Analysis:

  • Determination of kinetic parameters for different substrates

  • Analysis of processive vs. distributive polymerization mechanisms

  • Salt concentration effects on substrate binding and catalysis

Substrate VariantKm (μM)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)Salt Dependence
Native Lipid IITBDTBDTBDTBD
Modified variant 1TBDTBDTBDTBD
Modified variant 2TBDTBDTBDTBD
Modified variant 3TBDTBDTBDTBD

The table framework above should be populated through experimental determination, with particular attention to salt concentration effects given the halotolerant nature of S. denitrificans (growth in 0-6% salinity) .

How can structural biology approaches inform our understanding of S. denitrificans mtgA function and potential applications?

Advanced structural biology techniques provide crucial insights into mtgA function:

Crystallography and Cryo-EM:

  • Determination of high-resolution structures in different functional states

  • Co-crystallization with substrates and inhibitors

  • Analysis of potential salt bridges and adaptations for functioning in variable salinity

Molecular Dynamics Simulations:

  • Modeling of enzyme-membrane interactions in different ionic environments

  • Simulation of substrate binding and product release

  • Investigation of conformational changes during catalysis

Hydrogen-Deuterium Exchange Mass Spectrometry:

  • Identification of flexible regions involved in catalysis

  • Analysis of solvent accessibility changes upon substrate binding

  • Determination of potential allosteric regulatory sites

Structure-Guided Engineering Applications:

  • Development of modified variants with enhanced stability or altered substrate specificity

  • Design of immobilization strategies for biotechnological applications

  • Rational design of inhibitors targeting specific bacterial transglycosylases

How does S. denitrificans mtgA compare to similar enzymes in related Shewanella species?

Comparative analysis between S. denitrificans mtgA and homologs from closely related species (S. baltica, S. putrefaciens, and S. frigidimarina) provides evolutionary context:

Sequence Conservation Analysis:

  • Multiple sequence alignment to identify conserved catalytic residues

  • Examination of variable regions potentially involved in species-specific functions

  • Phylogenetic reconstruction of transglycosylase evolution within the Shewanella genus

Functional Comparison:

  • Side-by-side activity assays under standardized conditions

  • Substrate preference analysis across species

  • Thermal and pH stability comparisons

Expression Pattern Differences:

  • Analysis of genomic context and potential operon structures

  • Regulatory element comparison across species

  • Growth condition-dependent expression patterns

These comparative studies help identify conserved functional elements versus species-specific adaptations that may correlate with ecological niches, such as the oxic-anoxic interface habitat of S. denitrificans .

What insights can be gained from studying S. denitrificans mtgA in the context of bacterial adaptation to the oxic-anoxic interface?

S. denitrificans was isolated from the oxic-anoxic interface of an anoxic basin in the central Baltic Sea , suggesting adaptation to fluctuating oxygen conditions. This ecological context provides research opportunities:

Ecological Adaptation Studies:

  • Investigation of mtgA expression and activity across oxygen gradients

  • Analysis of peptidoglycan structure modifications in response to environmental transitions

  • Comparative studies with transglycosylases from strictly aerobic or anaerobic bacteria

Redox Sensitivity Analysis:

  • Identification of potentially redox-sensitive residues in mtgA

  • Examination of disulfide bond formation under varying redox conditions

  • Measurement of activity changes in response to oxidative stress

Environmental Mimicry Experiments:

  • Recreation of oxic-anoxic interface conditions in laboratory settings

  • Time-course analysis of mtgA expression during oxygen fluctuations

  • Correlating cell morphology changes with mtgA activity under transitional conditions

This research direction connects molecular enzyme function to broader ecological adaptations and may reveal novel regulatory mechanisms linking environmental sensing to cell wall synthesis.

What are common challenges in working with recombinant S. denitrificans mtgA and how can they be addressed?

Researchers frequently encounter specific challenges when working with recombinant transglycosylases:

Expression Challenges:

  • Low expression yields: Optimize codon usage for expression host; consider reduced temperature induction

  • Inclusion body formation: Test fusion partners like MBP or SUMO; explore periplasmic expression

  • Toxicity to host cells: Implement tightly controlled inducible systems; consider cell-free expression

Purification Difficulties:

  • Limited solubility: Screen detergent panel for optimal solubilization

  • Aggregation during concentration: Add glycerol or specific lipids; maintain salt concentration similar to S. denitrificans optimal growth (1-3%)

  • Loss of activity during purification: Minimize purification steps; include substrate analogs in buffers

Activity Assay Complications:

  • Inconsistent activity measurements: Standardize lipid II substrate preparation

  • Background enzymatic activity: Include appropriate controls from expression host

  • Interfering compounds: Purify enzyme thoroughly; test buffer components for inhibitory effects

Data Interpretation Issues:

  • Results variability: Implement technical and biological replicates; standardize assay conditions

  • Contradictory findings: Consider the influence of the facultative anaerobic nature of S. denitrificans on protein behavior

  • Limited comparative data: Generate parallel data with well-characterized transglycosylases as benchmarks

How can researchers address potential data contradictions when comparing in vitro and in vivo findings for S. denitrificans mtgA?

Discrepancies between in vitro biochemical data and in vivo observations are common in enzyme research. For S. denitrificans mtgA, researchers should consider:

Sources of Potential Contradictions:

  • Different ionic environments between purified systems and cellular conditions

  • Absence of protein interaction partners in reconstituted systems

  • Changes in redox state or post-translational modifications

  • Substrate availability and concentration differences

Reconciliation Approaches:

  • Develop cellular reporter systems to monitor mtgA activity in vivo

  • Implement in vivo crosslinking to identify interaction partners

  • Use genetic approaches (point mutations) to validate biochemical findings

  • Develop more complex reconstitution systems incorporating membrane components

Experimental Design Considerations:

  • Use complementary methodologies to address the same question

  • Carefully control environmental parameters (salt, pH, redox state)

  • Consider the natural growth environment of S. denitrificans at the oxic-anoxic interface

  • Test hypotheses across multiple strains or species to distinguish general principles from species-specific findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.