Recombinant Shewanella denitrificans Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Enzyme Composition and Function

The Na+-NQR complex consists of six subunits (NqrA–F) . NqrE, a membrane-spanning subunit, plays a role in electron transfer and sodium translocation. Key features include:

SubunitFunction
NqrABinds ubiquinone and NADH
NqrBHosts FMN cofactors; inhibitor binding site
NqrEInvolved in sodium translocation and electron transfer
NqrFNADH dehydrogenase activity

In Vibrio cholerae, NqrE contains a conserved glutamate residue (E95) critical for sodium transport . Mutagenesis studies show that substituting E95 disrupts Na+-dependent enzyme kinetics and reduces membrane potential generation .

Functional Role of NqrE-E95

Studies on V. cholerae NqrE-E95 mutants demonstrate its essential role in sodium translocation :

MutationNa+-Stimulated Activity (% of WT)Membrane Potential Efficiency
E95A15%40%
E95D25%55%
E95Q10%30%

Electrochemical analyses indicate that E95 mutations abolish the Na+-dependent redox potential modulation of FMN cofactors, directly linking this residue to cation transport .

Biotechnological and Pathogenic Relevance

  • Antibiotic Target: Na+-NQR is absent in eukaryotes, making it a promising target for bacterial pathogens like V. cholerae . Inhibitors like korormicin bind near NqrB-NqrE interfaces, disrupting ubiquinone reduction .

  • Energy Conservation: The enzyme’s sodium-pumping activity is critical for marine bacteria adapting to high-salt environments .

Research Gaps in Shewanella denitrificans

While S. denitrificans is a model denitrifier , its Na+-NQR system remains understudied. Genomic data suggest the presence of nqr operons, but experimental validation of NqrE’s role in this species is lacking. Comparative studies with Vibrio homologs provide a framework for hypothesizing similar mechanisms in Shewanella.

Table 1: Cation Dependence of Na+-NQR Activity

CationTurnover Rate (s⁻¹)
Na⁺220 ± 15
Li⁺180 ± 10
K⁺25 ± 5

Table 2: Inhibitor Effects on Na+-NQR

InhibitorBinding SiteIC₅₀ (nM)
Korormicin ANqrB-NqrE interface2.1
Aurachin D-42NqrB5.8

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; Sden_0986; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Target Names
nqrE
Target Protein Sequence
MEHYISLLIRSVFIENMALSFFLGMCTFLAVSKKVTTAMGLGVAVIVVLAISVPANQIIY QGILAPGALAWAGVPDADLSFLKFITFIGVIAALVQILEMTLDKYFPPLYNALGIFLPLI TVNCAIFGAVAFMVERDYNLTESLVFGVGSGIGWALAIVLLAAVREKMKYSDVPNGLRGL GITFISAGLMALGFMSFSGVSL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella denitrificans and what ecological niche does it occupy?

Shewanella denitrificans OS217 is a Gram-negative, rod-shaped, motile bacterium belonging to the gamma-Proteobacteria. It was isolated from the oxic-anoxic interface of an anoxic basin in the central Baltic Sea at a depth of approximately 130 meters . This organism is particularly significant for its vigorous denitrification capabilities, which enable it to reduce nitrate, nitrite, and sulphite as electron acceptors under anaerobic conditions .

S. denitrificans has adapted to live at the boundary between oxygenated and oxygen-depleted environments, making it an important model organism for studying redox processes in estuarine ecosystems. It can grow at salinities ranging from 0 to 6%, with optimal growth occurring between 1-3% salinity . Unlike some other Shewanella species that perform dissimilatory nitrate reduction to ammonium (DNRA), S. denitrificans performs complete denitrification, converting nitrate to nitrogen gas through a series of intermediate compounds .

How does the Na(+)-translocating NADH-quinone reductase (NQR) complex function in bacterial energy metabolism?

The Na(+)-translocating NADH-quinone reductase (NQR) complex is a unique respiratory enzyme that couples the oxidation of NADH to the generation of a sodium ion gradient across the bacterial membrane rather than a proton gradient. This respiratory complex plays a critical role in the energy metabolism of many marine and halophilic bacteria, including Shewanella denitrificans .

The NQR complex typically consists of six subunits (NqrA-F) and contains several redox cofactors including FAD, FeS clusters, and covalently bound FMN. The electron transfer pathway within the complex can be summarized as:

  • NADH binds to the complex and donates electrons

  • Electrons flow through various redox centers within the subunits

  • Quinones in the membrane are reduced

  • This electron transfer is coupled to Na+ translocation across the membrane

The resulting sodium gradient can then be utilized for various cellular processes, including ATP synthesis, substrate transport, and flagellar rotation. In S. denitrificans, this complex contributes to its ability to thrive in environments with fluctuating oxygen levels by providing an alternative mechanism for energy conservation .

What expression systems are most effective for producing recombinant S. denitrificans nqrE?

When expressing recombinant S. denitrificans nqrE, researchers should consider several factors specific to this membrane protein:

Recommended Expression Systems:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3)- Well-established protocol
- High yield potential
- Compatible with T7 promoter systems
- May require membrane protein-specific strains like C41/C43
- Codon optimization may be necessary
E. coli Lemo21(DE3)- Tunable expression
- Better for toxic/membrane proteins
- Requires titration of rhamnose to optimize expression
Shewanella species- Native environment for proper folding
- Natural cofactor incorporation
- Lower yields
- Less developed genetic tools

Expression Strategy:

  • Clone the nqrE gene (Sden_0984 based on genomic proximity to nqrD - Sden_0985) into a vector with an inducible promoter and affinity tag

  • Transform into the chosen expression host

  • Optimize expression conditions including temperature (typically 18-25°C for membrane proteins), inducer concentration, and expression duration

  • Consider co-expression with chaperones to improve folding

For membrane proteins like nqrE, lower induction temperatures and longer expression times often improve proper folding and membrane insertion, which is critical for obtaining functional protein .

What are the optimal methods for purifying recombinant nqrE while maintaining its native conformation and activity?

Purification of membrane proteins like nqrE presents unique challenges due to their hydrophobic nature and requirement for a membrane-like environment. Based on successful approaches with similar proteins, the following methodology is recommended:

Purification Protocol:

  • Membrane Isolation:

    • Harvest cells and disrupt by sonication or French press

    • Remove unbroken cells and debris by low-speed centrifugation

    • Isolate membranes by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization:

    • Resuspend membranes in buffer containing appropriate detergents

    • Recommended detergents: n-Dodecyl β-D-maltoside (DDM) at 1-2%, CHAPS, or digitonin

    • Incubate with gentle agitation at 4°C for 1-2 hours

  • Affinity Chromatography:

    • Apply solubilized sample to appropriate affinity resin based on tag (His-tag, FLAG-tag)

    • For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Include low concentrations of detergent in all buffers (typically 0.02-0.05% DDM)

  • Additional Purification:

    • Size exclusion chromatography to isolate properly folded protein and assess oligomeric state

    • Consider blue-Sepharose affinity chromatography, which has shown success with NADH-binding proteins

  • Storage:

    • Store in buffer containing 50% glycerol at -20°C for extended storage

    • Avoid repeated freeze-thaw cycles

The purification should be performed rapidly at 4°C to minimize protein degradation. Include protease inhibitors in early purification steps and consider adding stabilizing agents such as glycerol throughout the process.

How can researchers effectively measure the enzymatic activity of recombinant nqrE and the entire NQR complex?

Individual nqrE Subunit Activity:

  • Quinone Reduction Assay:

    • Monitor the reduction of ubiquinone analogs (e.g., ubiquinone-1, ubiquinone-10)

    • Follow absorbance decrease at 275-290 nm

    • Perform in the presence of appropriate detergent micelles

Reconstituted NQR Complex Activity:

  • NADH Oxidation Assay:

    • Measure the oxidation of NADH spectrophotometrically at 340 nm

    • Initial velocity measurements under varying substrate concentrations for kinetic analysis

    • Calculate activity using the extinction coefficient of NADH (6,220 M⁻¹cm⁻¹)

  • Na⁺ Transport Assay:

    • Reconstitute purified NQR complex into liposomes

    • Monitor Na⁺ transport using fluorescent dyes (e.g., Sodium Green) or Na⁺-selective electrodes

    • Assess coupling efficiency between NADH oxidation and Na⁺ translocation

  • Electron Transfer Measurement:

    • Use artificial electron acceptors like ferricyanide or benzyl viologen

    • Monitor rate of reduction spectrophotometrically

    • Compare activity with native complex to assess functionality

Data Analysis:

  • Apply Michaelis-Menten kinetics to determine Km and Vmax parameters

  • For inhibition studies, analyze using appropriate models (competitive, non-competitive)

  • When interpreting data, consider that mixed-type inhibition has been observed with related NADH-dependent reductases

How does the NQR complex in S. denitrificans relate to its denitrification capabilities and environmental adaptation?

The NQR complex in S. denitrificans represents a fascinating intersection between respiration and environmental adaptation. Current research suggests several important relationships:

Bioenergetic Cooperation:
The Na(+)-translocating NADH-quinone reductase complex plays a critical role in generating the energy needed for various cellular processes, including denitrification. S. denitrificans' ability to perform complete denitrification from nitrate to nitrogen gas requires significant energy investment, which may be partially supplied by the Na+ gradient established by the NQR complex .

Ecological Niche Adaptation:
S. denitrificans was isolated from the oxic-anoxic interface of the Baltic Sea, an environment characterized by fluctuating oxygen and redox conditions. The NQR complex may provide a competitive advantage in this niche by:

  • Functioning efficiently under low oxygen conditions

  • Contributing to energy conservation when alternate electron acceptors are used

  • Helping maintain redox homeostasis during transitions between aerobic and anaerobic metabolism

Metabolic Versatility:
Recent research has shown that some Shewanella species, including S. denitrificans, can utilize acetate as an electron donor specifically for denitrification but not for other anaerobic respiratory processes. The NQR complex may be involved in the electron transfer chains that make this selective substrate utilization possible .

How to resolve contradictory results when analyzing recombinant nqrE function in experimental settings?

When working with complex membrane proteins like nqrE, researchers often encounter seemingly contradictory results. Addressing these contradictions requires a systematic approach:

Methodological Framework for Resolving Contradictions:

  • Identify the Nature of the Contradiction:

    • Activity discrepancies between preparations

    • Structural inconsistencies

    • Unexpected substrate preferences

    • Conflicting kinetic parameters

  • Examine Protein Integrity:

    • Verify protein purity via SDS-PAGE and mass spectrometry

    • Confirm proper folding through circular dichroism or limited proteolysis

    • Check for post-translational modifications that might affect function

    • Assess oligomeric state using size exclusion chromatography or native PAGE

  • Consider Environmental Variables:

    • Test activity across different pH ranges and salt concentrations

    • Examine temperature sensitivity of enzyme activity

    • Evaluate effects of different detergents on protein stability and function

    • Assess potential inhibitors in buffers or reagents

  • Apply Interpretive Listening Approach:

    • As noted in search result , contradictions often reflect deeper underlying processes

    • Look beyond immediate results to understand the "logic of practice"

    • Consider that apparent contradictions may reveal previously unrecognized protein behaviors

  • Contextual Analysis:

    • Compare results with heterologously expressed protein versus native protein

    • Consider whether the protein functions differently in isolation versus in a complex

    • Examine whether the contradiction reveals physiologically relevant regulatory mechanisms

Case Example:
In studies of related NADH-dependent reductases, contradictory results regarding substrate specificity were resolved by discovering that NAD+ concentration significantly affected enzyme behavior in ways that appeared inconsistent until the regulatory mechanism was understood .

What research approaches can help elucidate the structure-function relationship of nqrE in the NQR complex?

Understanding the structure-function relationship of nqrE requires integrating multiple experimental approaches:

Structural Analysis Techniques:

TechniqueApplication to nqrEAdvantagesLimitations
X-ray CrystallographyDetermine high-resolution structureAtomic-level resolutionChallenging for membrane proteins
Cryo-Electron MicroscopyVisualize entire NQR complexWorks with larger complexesLower resolution for small details
NMR SpectroscopyProbe dynamics and interactionsCan study in solution stateSize limitations
Site-Directed Spin LabelingMap conformational changesWorks in native-like environmentRequires strategic labeling

Functional Mapping Approaches:

  • Site-Directed Mutagenesis:

    • Target conserved residues across NQR family

    • Create systematic alanine scanning library

    • Focus on predicted Na+ channel residues

    • Analyze impact on both electron transfer and ion translocation

  • Chimeric Protein Analysis:

    • Swap domains between nqrE from different Shewanella species

    • Create fusion constructs with homologous proteins

    • Identify regions essential for species-specific behaviors

  • Cross-linking Studies:

    • Use chemical cross-linkers to map protein-protein interactions

    • Identify interaction interfaces between nqrE and other NQR subunits

    • Combine with mass spectrometry for precise mapping

  • Computational Approaches:

    • Molecular dynamics simulations to study Na+ movement

    • Homology modeling based on related structures

    • Quantum mechanical calculations for electron transfer pathways

Integration Strategy:
Correlate structural elements with specific functions by combining:

  • Biophysical measurements of electron transfer rates

  • Ion transport assays following strategic mutations

  • Evolutionary analysis of conserved residues

  • Computational predictions of structure-based mechanisms

What are common challenges in expressing and purifying functional recombinant nqrE, and how can they be overcome?

Researchers working with recombinant nqrE often face several challenges that can be addressed with specific methodological solutions:

Challenge 1: Poor Expression Yields

  • Cause: Membrane protein toxicity to host cells, codon usage bias, protein misfolding

  • Solutions:

    • Use specialized expression strains designed for toxic/membrane proteins (C41/C43)

    • Optimize codon usage for expression host

    • Lower induction temperature to 18-20°C

    • Express as fusion with solubility-enhancing partners (MBP, SUMO)

    • Consider cell-free expression systems for highly toxic constructs

Challenge 2: Protein Aggregation/Inclusion Bodies

  • Cause: Improper folding, inadequate membrane insertion, overexpression

  • Solutions:

    • Reduce expression rate using lower inducer concentrations

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Add specific lipids to growth media

    • For recovery from inclusion bodies, use specialized refolding protocols with gradual detergent addition

Challenge 3: Loss of Activity During Purification

  • Cause: Cofactor loss, detergent effects, oxidation of redox centers

  • Solutions:

    • Screen multiple detergents at various concentrations

    • Add stabilizing agents (glycerol, specific lipids, cofactors)

    • Include reducing agents (DTT, β-mercaptoethanol) to prevent oxidation

    • Maintain strict temperature control throughout purification

    • Consider purification under anaerobic conditions

Challenge 4: Poor Complex Assembly

  • Cause: Incomplete complex formation, improper subunit stoichiometry

  • Solutions:

    • Co-express multiple or all NQR subunits simultaneously

    • Purify using tandem affinity tags on different subunits

    • Reconstitute complex from individually purified components under controlled conditions

    • Verify complex integrity using blue native PAGE or analytical ultracentrifugation

Challenge 5: Limited Stability

  • Cause: Detergent-induced destabilization, cofactor loss over time

  • Solutions:

    • Transfer protein to more stable environments (nanodiscs, amphipols, styrene-maleic acid copolymer lipid particles)

    • Add specific lipids known to stabilize membrane proteins

    • Store with appropriate cofactors and reducing agents

    • Consider rapid analysis methods immediately following purification

How can researchers distinguish between the functions of individual NQR subunits versus the entire complex?

Isolated Subunit Analysis:

  • Expression of Individual Subunits:

    • Express nqrE and other subunits individually with appropriate tags

    • Purify under conditions that maintain native conformation

    • Characterize biophysical properties (stability, cofactor binding, etc.)

  • Partial Complex Reconstitution:

    • Systematically combine different subunit combinations

    • Measure activity with each addition to identify cooperative effects

    • Determine minimal functional units for specific activities

  • Complementation Assays:

    • Create deletion strains lacking specific NQR subunits

    • Complement with wild-type or mutant versions on plasmids

    • Assess restoration of function to identify essential activities

Functional Mapping Techniques:

Data Integration Approach:
Researchers should integrate findings from:

  • Structural studies of individual subunits and complexes

  • Kinetic analysis of partial and complete assemblies

  • Comparative genomics across different bacterial species

  • Evolutionary analysis of conserved features

This multi-layered approach can help distinguish which functions are intrinsic to nqrE alone versus those that emerge from its interactions within the complete NQR complex .

What are the most reliable methods for studying the electron transport mechanisms involving the NQR complex in S. denitrificans?

Investigating electron transport through the NQR complex requires specialized techniques to capture the rapid and complex redox chemistry:

Spectroscopic Methods:

  • UV-Visible Spectroscopy:

    • Track changes in cofactor absorbance during catalysis

    • Monitor NADH oxidation at 340 nm

    • Follow quinone reduction at appropriate wavelengths

    • Perform stopped-flow experiments for rapid kinetics

  • Electron Paramagnetic Resonance (EPR):

    • Identify and characterize paramagnetic intermediates

    • Study semiquinone formation during catalysis

    • Examine iron-sulfur cluster reduction states

    • Perform freeze-quench experiments to capture transient species

  • Fluorescence Spectroscopy:

    • Monitor NADH binding through intrinsic fluorescence

    • Use fluorescent probes to track conformational changes

    • Measure Na+ transport with sodium-sensitive fluorophores

Electrochemical Approaches:

  • Protein Film Voltammetry:

    • Immobilize purified NQR complex on electrode surfaces

    • Directly measure electron transfer to/from the protein

    • Determine redox potentials of individual cofactors

    • Study the effects of inhibitors and substrate analogs

  • Potentiometric Titrations:

    • Determine midpoint potentials of redox centers

    • Map the thermodynamic landscape of electron transfer

    • Identify potential bottlenecks in electron flow

In vivo and Membrane-based Studies:

Data Analysis Frameworks:

When integrating these approaches, researchers should consider the unique denitrification capabilities of S. denitrificans when designing experiments and interpreting results .

How might research on S. denitrificans NQR complex contribute to our understanding of bacterial energy metabolism and environmental adaptation?

Research on the Na(+)-translocating NADH-quinone reductase complex in Shewanella denitrificans opens several promising avenues for expanding our understanding of bacterial bioenergetics:

Evolutionary Insights:

  • Comparing NQR complexes across different Shewanella species can reveal how these energy-conserving systems adapted to various ecological niches

  • Analyzing the co-evolution of NQR with denitrification machinery may uncover functional linkages between these pathways

  • Studying horizontal gene transfer patterns of nqr genes could reveal the spread of Na+-based bioenergetics across bacterial lineages

Bioenergetic Flexibility:

  • Understanding how S. denitrificans switches between different electron donors (acetate vs. lactate) specifically for denitrification

  • Investigating whether the NQR complex contributes to the organism's ability to thrive at oxic-anoxic interfaces

  • Determining how S. denitrificans balances energy production between aerobic respiration, denitrification, and potentially other pathways

Environmental Applications:

  • Exploring the potential of S. denitrificans in bioremediation of nitrate-contaminated environments

  • Investigating the role of NQR in metal reduction processes, similar to those observed in other Shewanella species

  • Developing biosensors based on the NQR complex for environmental monitoring

Biotechnological Potential:

  • Utilizing the redox capabilities of the NQR complex for biotechnological applications, such as bioelectricity generation

  • Engineering S. denitrificans with modified NQR complexes for enhanced bioremediation capabilities

  • Exploring the possibility of using NQR-based systems for sustainable energy production in microbial fuel cells

This research has broad implications ranging from fundamental understanding of bacterial physiology to practical applications in environmental science and biotechnology.

What emerging technologies might enhance our ability to study the structure and function of membrane proteins like nqrE?

Several cutting-edge technologies are poised to revolutionize the study of membrane proteins like nqrE:

Advanced Structural Biology Approaches:

  • Cryo-Electron Tomography:

    • Visualize membrane proteins in their native cellular environment

    • Study NQR complex organization within the bacterial membrane

    • Observe structural changes during catalytic cycles

  • Microcrystal Electron Diffraction (MicroED):

    • Determine high-resolution structures from nanocrystals

    • Overcome challenges of growing large membrane protein crystals

    • Access structures of previously intractable proteins

  • Integrative Structural Biology:

    • Combine multiple structural techniques (X-ray, cryo-EM, NMR, SAXS)

    • Create comprehensive models that capture both structure and dynamics

    • Incorporate computational methods to fill experimental gaps

Functional Characterization Technologies:

  • Single-Molecule Techniques:

    • Track conformational changes during catalysis

    • Observe heterogeneity in protein behavior

    • Correlate structural dynamics with function

  • Advanced Microscopy:

    • Super-resolution imaging of labeled NQR complexes

    • FRET-based approaches to measure distances between subunits

    • Live-cell imaging to track assembly and localization

  • Nanoscale Biosensors:

    • Surface plasmon resonance for kinetic measurements

    • Nanopore-based single-molecule detection

    • Quartz crystal microbalance for binding studies

Computational Advances:

  • AI-Driven Structure Prediction:

    • Tools like AlphaFold and RoseTTAFold for accurate structure prediction

    • Specific adaptations for membrane protein modeling

    • Integration with experimental data for hybrid approaches

  • Advanced Molecular Simulations:

    • Enhanced sampling methods to access longer timescales

    • Polarizable force fields for more accurate membrane protein simulations

    • Quantum mechanical/molecular mechanical approaches for redox chemistry

  • System-Level Modeling:

    • Multi-scale simulations connecting molecular events to cellular outcomes

    • Genome-scale metabolic models incorporating NQR function

    • Predictive models of bacterial adaptation to environmental changes

These emerging technologies, when applied to the study of nqrE and the NQR complex, promise to provide unprecedented insights into the structure-function relationships of this important membrane protein system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.