Recombinant Shewanella denitrificans Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Structure-Function Relationship

UbiB is classified as a probable protein kinase involved in ubiquinone biosynthesis . The protein contains regions critical for ATP binding and catalytic activity, which enable its function in the complex biosynthetic pathway leading to ubiquinone production. The conserved nature of UbiB across Shewanella species suggests that the S. denitrificans variant maintains similar catalytic capabilities while potentially possessing unique adaptations related to its denitrifying metabolism.

Ubiquinone Biosynthesis in S. denitrificans

Unlike most other Shewanella species that encode proteins for both menaquinone and ubiquinone biosynthesis, S. denitrificans specifically encodes ubiquinone biosynthesis proteins . This metabolic specialization represents a significant deviation from the typical Shewanella profile and aligns S. denitrificans more closely with dedicated denitrifying bacteria such as Paracoccus denitrificans and Ralstonia eutropha, which also lack menaquinone biosynthesis genes .

Quinone Pools and Respiratory Function

The ubiquinone dominance in S. denitrificans contrasts with the quinone profile of most Shewanella species, which typically produce both ubiquinols and menaquinols, with the ratio varying depending on oxygen availability . Under aerobic conditions, ubiquinols (specifically ubiquinol 7 and 8) generally predominate, while anaerobic conditions favor menaquinol production . The absence of menaquinone biosynthesis genes in S. denitrificans suggests a specialized respiratory chain optimized for its denitrifying lifestyle.

Role in Denitrification Pathways

S. denitrificans stands out among Shewanella species for its robust denitrification capabilities. Experimental evidence has established it as a "vigorous denitrifier" capable of the complete denitrification pathway from nitrate to nitrogen gas . This metabolic capability relies on a specific suite of enzymes including periplasmic nitrate reductase (NAP-a), copper-containing nitrite reductase (NirK), nitric oxide reductase (NorB), and nitrous oxide reductase (NosZ) .

Correlation Between Ubiquinone and Denitrification

The specialized ubiquinone biosynthesis machinery in S. denitrificans, including UbiB, appears integral to its denitrification capabilities. Unlike most Shewanella species that encode both NAP-a and NAP-b forms of periplasmic nitrate reductase, S. denitrificans exclusively possesses the NAP-a form . This specialization suggests that the ubiquinone-dominated electron transport chain in S. denitrificans may be specifically adapted for efficient electron flow to the denitrification machinery.

The table below summarizes the key respiratory enzymes and quinone biosynthesis proteins in S. denitrificans compared to other Shewanella species:

SpeciesNAP-aNAP-bNirKNorBNosZNrfAUbiBMenD
S. denitrificansPresentAbsentPresentPresentPresentAbsentPresentAbsent
S. oneidensis MR-1AbsentPresentAbsentAbsentAbsentPresentPresentPresent
Most Shewanella speciesPresentPresentAbsentAbsentAbsentPresentPresentPresent

Recombinant Production of S. denitrificans UbiB

The production of recombinant S. denitrificans UbiB protein follows methodologies similar to those established for other Shewanella UbiB proteins. Based on protocols for related proteins, recombinant production typically involves expression in E. coli systems with the addition of affinity tags (commonly His-tags) to facilitate purification .

Expression and Purification Protocol

For recombinant production, the ubiB gene from S. denitrificans can be cloned into expression vectors with N-terminal or C-terminal His-tags. Expression in E. coli under controlled conditions allows for efficient protein production, followed by purification using affinity chromatography. The purified protein is typically obtained as a lyophilized powder with purity exceeding 90% as determined by SDS-PAGE .

Comparative Analysis with UbiB from Other Shewanella Species

Comparing UbiB from S. denitrificans with homologs from S. oneidensis and S. amazonensis reveals insights into the conservation and specialization of this protein across the genus. While all three species produce UbiB proteins of similar length (approximately 549 amino acids), subtle differences in sequence may reflect adaptations to their distinct metabolic requirements .

Sequence Conservation and Variation

Based on the available sequences for S. oneidensis and S. amazonensis UbiB proteins, we can infer that the S. denitrificans variant likely maintains high sequence identity with these homologs while potentially possessing unique residues related to its specific role in the ubiquinone-exclusive respiratory system . The S. oneidensis UbiB contains characteristic motifs for ATP binding and substrate interaction that are likely conserved in the S. denitrificans protein .

Functional Implications in Electron Transport

The specialized role of UbiB in S. denitrificans relates to its ubiquinone-dominated electron transport chain, which differs significantly from most other Shewanella species that utilize both ubiquinone and menaquinone . This specialization appears connected to the organism's denitrification capability.

Electron Transfer Mechanisms

In Shewanella species, different periplasmic nitrate reductase systems (NAP-a and NAP-b) interact preferentially with different quinol pools . The NAP-a system found in S. denitrificans utilizes a tetrahaem cytochrome-c NapC, while the NAP-b system absent in S. denitrificans employs iron-sulfur cluster ferredoxins (NapGH) . The exclusive presence of NAP-a in S. denitrificans, coupled with its ubiquinone-dominated metabolism, suggests a specialized electron transfer pathway optimized for denitrification.

Research in E. coli has demonstrated that NapC (present in the NAP-a system) can function with either ubiquinol or menaquinol as electron donors . The specialization of S. denitrificans for ubiquinone biosynthesis, facilitated by UbiB, likely reflects an adaptation that optimizes electron flow through its NAP-a system to support efficient denitrification.

Research Applications and Future Directions

Recombinant S. denitrificans UbiB protein represents a valuable tool for studying ubiquinone biosynthesis and its connection to denitrification pathways. Future research directions may include:

  1. Detailed structural characterization of S. denitrificans UbiB through crystallography or cryo-EM

  2. Comparative functional studies examining UbiB activity across different Shewanella species

  3. Investigation of potential inhibitors targeting UbiB as tools for manipulating denitrification

  4. Exploration of biotechnological applications leveraging the ubiquinone biosynthesis pathway in S. denitrificans

Potential Biotechnological Applications

The specialized ubiquinone biosynthesis machinery in S. denitrificans, including UbiB, may have applications in:

  1. Bioremediation of nitrate-contaminated environments

  2. Development of biosensors for nitrogen compounds

  3. Engineered systems for nitrogen removal in wastewater treatment

  4. Production of ubiquinone (coenzyme Q) for nutritional and pharmaceutical applications

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiB; Sden_0459; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-549
Protein Length
full length protein
Species
Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Target Names
ubiB
Target Protein Sequence
MSISSLHRGYQVLRTLLHYGLDELLAKDKRPKLFPLIRGCFFWIRNQHKDKSAAERLKLA MQELGPVYIKLGQMLSTRRDLLDDEWAYQLAMLQDRVPPFDSALAREAIETELNASIDSL FDDFDDVPLASASIAQVHSATLKSNGKAVVLKVLRPNVEALILADLQLMSHCAALLERIL GDGNRLRPAEVIEDYRLTILGELNLKLEALNAIKLRNNFLDSDALYVPYIYEDLSFTRLI VMERIYGIAVSDLSALKAQGTNLKLLAERGVELFFTQVFRDNFFHADMHPGNIFISRDHP DNPYYIGLDCGIMGTLTDVDKRYLAENFLAFFNRDYQRIAQLHLESGWVSEHTDIVAFEQ AIKIVCEPMFNKPLAEISFGHVLLALFRTARQFNMVVQPQLVLLQKTLLYIEGLGRQLYP QLDLWQTAKPFLEQWMAKQVGPKALFDKFKSNAPFWAEKLPELPELVYDNLKLGRKLLGT QQQMLDKYLKYQHKAHKSNYLLITSAVFVICGTILFTQAVTLWASLLCLGTGAGLWLLGW QARPKNRKL
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella denitrificans and what makes it significant for UbiB protein research?

Shewanella denitrificans is a species of denitrifying estuarine bacteria initially isolated from the oxic-anoxic interface of an anoxic basin in the central Baltic Sea. It belongs to the gamma-Proteobacteria and is characterized as unpigmented, polarly flagellated, mesophilic, and facultatively anaerobic . The species is notable for its vigorous denitrification capabilities, being able to use nitrate, nitrite, and sulphite as electron acceptors . These characteristics make S. denitrificans an interesting model organism for studying proteins involved in respiratory pathways and redox reactions, including the ubiquinone biosynthesis protein UbiB. The organism's ability to thrive in environments with varying oxygen availability makes it valuable for studying proteins like UbiB that are involved in electron transport chains and energy metabolism.

What is the general function of ubiquinone biosynthesis protein UbiB in bacteria?

The ubiquinone biosynthesis protein UbiB plays a crucial role in the synthesis pathway of ubiquinone (coenzyme Q), which is an essential component of the electron transport chain in many bacteria. Based on analyses of similar proteins in related species like Shewanella oneidensis, UbiB is classified as both a "Probable ubiquinone biosynthesis protein" and a "Probable protein kinase UbiB" . The protein is involved in the aerobic ubiquinone biosynthetic pathway, which is essential for respiratory metabolism under aerobic conditions. UbiB is believed to function as a kinase that phosphorylates a precursor in the ubiquinone biosynthesis pathway, though its exact mechanistic role continues to be a subject of research. In facultative anaerobes like Shewanella species, UbiB's regulated expression may be particularly important for adaptations to varying oxygen conditions.

How does S. denitrificans UbiB compare structurally to UbiB proteins in other bacterial species?

While specific structural information about S. denitrificans UbiB is limited in current literature, comparative analysis can be made with the better-characterized UbiB from Shewanella oneidensis. The UbiB protein from S. oneidensis is a full-length protein of 549 amino acids . Sequence analysis of UbiB proteins across Shewanella species shows conservation of key functional domains, including regions associated with kinase activity and ubiquinone biosynthesis. When examining protein structures through homology modeling, UbiB typically contains nucleotide-binding domains consistent with its putative kinase function. Additionally, bacterial UbiB proteins often contain transmembrane or membrane-associated domains, reflecting their involvement in the membrane-localized process of ubiquinone biosynthesis. Detailed structural comparisons using bioinformatics tools would reveal specific conserved motifs among Shewanella species, providing insights into functional conservation.

What are the optimal conditions for expressing recombinant S. denitrificans UbiB protein?

For optimal expression of recombinant S. denitrificans UbiB protein, an Escherichia coli expression system similar to that used for other Shewanella proteins is recommended. Based on successful expression of comparable proteins, the following protocol provides a methodological approach:

  • Vector selection: pET-based vectors with an N-terminal His-tag for purification are recommended .

  • Host strain: E. coli BL21(DE3) or Rosetta strains are preferred for membrane-associated proteins.

  • Growth conditions: Culture in LB medium at 37°C until OD600 reaches 0.6-0.8.

  • Induction: Lower the temperature to 18-20°C and induce with 0.1-0.5 mM IPTG.

  • Post-induction: Continue expression for 16-18 hours at the reduced temperature.

This approach minimizes inclusion body formation while maximizing yield of properly folded protein. The lower induction temperature is particularly important for maintaining the stability and proper folding of this complex protein. Expression levels should be monitored by SDS-PAGE and Western blot using anti-His antibodies to confirm successful production.

What purification strategy yields the highest purity and activity for recombinant S. denitrificans UbiB?

A multi-step purification strategy is recommended to achieve high purity and maintain the activity of recombinant S. denitrificans UbiB:

  • Cell lysis: Use a combination of lysozyme treatment (1 mg/ml, 30 min on ice) followed by sonication in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors.

  • Initial purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with the following buffer system:

    • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 10 mM imidazole

    • Wash buffer: Same as binding buffer with 20-30 mM imidazole

    • Elution buffer: Same as binding buffer with 250-300 mM imidazole

  • Secondary purification: Size exclusion chromatography using a Superdex 200 column with buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 5% glycerol.

  • Storage: Store purified protein in aliquots at -80°C in storage buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 1 mM DTT .

This strategy typically yields protein with >90% purity as determined by SDS-PAGE, suitable for biochemical and structural studies. Activity should be assessed through specific kinase assays or ubiquinone biosynthesis pathway reconstitution experiments.

How can researchers verify the functional activity of purified recombinant S. denitrificans UbiB?

Verifying the functional activity of purified recombinant S. denitrificans UbiB requires multiple complementary approaches:

  • Kinase activity assay: As UbiB is proposed to function as a protein kinase, assess phosphorylation activity using:

    • ATP consumption assay (ADP-Glo™)

    • Radiolabeled ATP incorporation into potential substrates

    • Phosphate release detection using malachite green

  • Complementation studies: Transform ubiB-deficient bacterial strains with a plasmid expressing S. denitrificans UbiB and assess restoration of:

    • Ubiquinone biosynthesis (by HPLC analysis)

    • Aerobic growth capabilities

    • Respiratory chain function

  • Binding assays: Examine interaction with known UbiB substrates or partners using:

    • Isothermal titration calorimetry (ITC)

    • Surface plasmon resonance (SPR)

    • Pull-down assays followed by mass spectrometry

  • Structural integrity verification: Employ circular dichroism (CD) spectroscopy to confirm proper protein folding and thermal stability profiles.

A combination of these approaches provides robust validation of functional activity. Results should be compared against positive controls (known active UbiB from related species) and negative controls (catalytically inactive mutants) to ensure specificity.

How does the extracellular electron transfer capability of Shewanella species relate to UbiB function?

The extracellular electron transfer (EET) capability of Shewanella species represents one of their most distinctive physiological traits, allowing them to reduce a wide variety of external electron acceptors including Fe, Mn, Tc, and V minerals . While UbiB's primary role is in ubiquinone biosynthesis, its function intersects with EET pathways through several mechanistic connections:

Experimental evidence from related Shewanella species indicates that disruptions in ubiquinone biosynthesis pathways can impair EET capabilities, suggesting a functional relationship between these systems. This relationship is particularly relevant in S. denitrificans, which exhibits vigorous denitrification capabilities requiring robust electron transport systems .

What are the major challenges in crystallizing S. denitrificans UbiB for structural studies?

Crystallizing S. denitrificans UbiB for structural studies presents several significant challenges that researchers must address:

  • Membrane association: UbiB proteins typically have membrane-associated domains that introduce hydrophobic regions, complicating solubilization and crystallization. Strategies to overcome this include:

    • Using mild detergents (DDM, LMNG, or CHAPSO) for extraction

    • Employing lipidic cubic phase crystallization techniques

    • Creating fusion constructs with crystallization chaperones like T4 lysozyme

  • Conformational heterogeneity: As a kinase, UbiB likely adopts multiple conformational states depending on nucleotide binding and substrate interaction status. Approaches to address this include:

    • Co-crystallization with ATP analogs or substrates to stabilize specific conformations

    • Introduction of mutations that lock the protein in defined states

    • Implementation of limited proteolysis to identify and remove flexible regions

  • Post-translational modifications: Potential phosphorylation or other modifications may create heterogeneity in the protein sample. Solutions include:

    • Mass spectrometry analysis to identify modifications

    • Site-directed mutagenesis of modification sites

    • Homogeneous expression systems with controlled modification patterns

  • Protein stability: UbiB may exhibit limited stability in solution. Stability can be enhanced through:

    • Buffer optimization through thermal shift assays

    • Addition of specific ligands or substrates

    • Engineering disulfide bonds to stabilize tertiary structure

A systematic approach addressing these challenges, potentially using orthologues from multiple Shewanella species for parallel crystallization trials, offers the best probability of success in structural determination.

How can researchers investigate UbiB's role in the adaptation of S. denitrificans to changing environmental conditions?

Investigating UbiB's role in S. denitrificans' adaptation to changing environmental conditions requires a multi-faceted experimental approach:

  • Gene expression analysis:

    • Perform RT-qPCR or RNA-seq under varying environmental conditions (oxygen levels, nitrogen availability, metal presence)

    • Monitor ubiB expression patterns during transitions between aerobic and anaerobic growth

    • Compare expression with other respiratory genes to identify co-regulation patterns

  • Gene knockout and complementation studies:

    • Generate ubiB deletion mutants in S. denitrificans

    • Assess growth and metabolic parameters under various environmental stresses

    • Perform complementation with wild-type and mutant versions of ubiB

    • Measure fitness impacts during environmental transitions

  • Metabolomic analysis:

    • Quantify ubiquinone and related metabolite levels using LC-MS/MS

    • Monitor shifts in central metabolism during environmental transitions

    • Assess redox cofactor status (NAD+/NADH, NADP+/NADPH ratios)

  • Physiological characterization:

    • Measure growth rates, substrate utilization, and product formation under varying conditions

    • Assess oxygen consumption rates and alternative terminal electron acceptor utilization

    • Examine biofilm formation and cellular ultrastructure using electron microscopy

These approaches can be integrated to develop a comprehensive model of how UbiB contributes to S. denitrificans' remarkable adaptability to changing redox conditions, particularly in estuarine environments where oxygen and electron acceptor availability fluctuate significantly .

What control experiments are essential when studying recombinant S. denitrificans UbiB function?

When studying recombinant S. denitrificans UbiB function, the following control experiments are essential for rigorous scientific investigation:

  • Enzyme activity controls:

    • Negative control: Heat-inactivated UbiB protein

    • Positive control: Well-characterized UbiB from a related species (e.g., S. oneidensis)

    • Catalytic mutant: UbiB with mutations in predicted catalytic residues

    • Substrate specificity control: Assays with non-physiological substrates

  • Expression and purification controls:

    • Empty vector control: Cells transformed with expression vector lacking the ubiB gene

    • Tag-only control: Expression of the affinity tag without UbiB

    • Purification background: Samples from purification of non-transformed cells

  • Complementation controls:

    • Vector-only control: ubiB knockout complemented with empty vector

    • Heterologous complementation: ubiB knockout complemented with UbiB from different species

    • Point mutant complementation: ubiB knockout complemented with catalytically inactive UbiB

  • Physical characterization controls:

    • Protein stability: Monitor protein stability under various buffer conditions

    • Oligomerization state: Determine native oligomerization state by size exclusion chromatography

    • Thermal denaturation: Assess protein folding and stability via thermal shift assays

These controls help distinguish specific UbiB-dependent effects from artifacts and ensure the reliability and reproducibility of experimental findings.

How should researchers design experiments to investigate UbiB's interaction with other proteins in the ubiquinone biosynthesis pathway?

Designing experiments to investigate UbiB's interaction with other proteins in the ubiquinone biosynthesis pathway requires a systematic approach that combines in vitro and in vivo methods:

  • Identification of potential interaction partners:

    • Bioinformatic analysis of genomic context and co-occurrence patterns

    • Bacterial two-hybrid screening using UbiB as bait

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID or APEX)

  • Validation of direct protein-protein interactions:

    • Pull-down assays with purified recombinant proteins

    • Surface plasmon resonance (SPR) or biolayer interferometry (BLI) for binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis (MST) for interactions in solution

  • Mapping interaction domains and residues:

    • Truncation constructs to identify minimal interaction domains

    • Alanine scanning mutagenesis of predicted interface residues

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Crosslinking coupled with mass spectrometry (XL-MS)

  • Functional characterization of interactions:

    • Reconstitution of partial or complete pathways in vitro

    • Activity assays in the presence or absence of interaction partners

    • Co-expression studies and metabolite quantification

    • FRET or BRET assays to monitor interactions in living cells

These experimental approaches should be complemented with computational modeling of protein-protein interactions based on available structural data or homology models, which can guide the design of targeted mutations to disrupt specific interfaces.

What analytical techniques are most appropriate for detecting changes in ubiquinone levels in S. denitrificans upon UbiB manipulation?

The accurate detection and quantification of changes in ubiquinone levels upon UbiB manipulation requires sophisticated analytical techniques:

  • Chromatographic methods:

    • High-Performance Liquid Chromatography (HPLC) with UV detection at 275 nm

    • Ultra-Performance Liquid Chromatography (UPLC) for enhanced resolution

    • Liquid Chromatography coupled with Mass Spectrometry (LC-MS/MS) for definitive identification and quantification

  • Sample preparation protocol:

    • Cell harvesting at mid-logarithmic phase

    • Extraction with 1:1 methanol:hexane or ethanol:hexane mixture

    • Phase separation and collection of the hexane phase

    • Concentration under nitrogen stream

    • Resuspension in ethanol or methanol for analysis

  • Standards and calibration:

    • Use of commercial ubiquinone-8 (UQ8) and ubiquinone-10 (UQ10) standards

    • Internal standard addition (e.g., ubiquinone-4) for quantification

    • Five-point calibration curve covering physiological concentration range

  • Data analysis and validation:

    • Integration of peak areas for quantification

    • Normalization to cell dry weight or protein content

    • Statistical analysis of biological replicates (minimum n=3)

    • Identification confirmation by MS/MS fragmentation patterns

The following table outlines typical chromatographic conditions for ubiquinone analysis:

ParameterHPLC ConditionsUPLC-MS/MS Conditions
ColumnC18 reverse phase (150 × 4.6 mm, 5 μm)C18 reverse phase (100 × 2.1 mm, 1.7 μm)
Mobile phaseMethanol:Hexane (9:1)A: 0.1% formic acid in water
B: 0.1% formic acid in methanol
GradientIsocratic70-100% B over 10 min
Flow rate1.0 mL/min0.3 mL/min
Temperature30°C40°C
DetectionUV 275 nmESI+ mode, MRM
Run time20 min15 min
LOD~0.1 μg/mL~1 ng/mL

These analytical approaches provide complementary information, with HPLC offering accessibility and robustness, while LC-MS/MS provides superior sensitivity and specificity for comprehensive ubiquinone profiling in response to UbiB manipulation.

How might S. denitrificans UbiB function in metal-reducing metabolic pathways relevant to bioremediation?

S. denitrificans UbiB likely plays a significant indirect role in metal-reducing metabolic pathways through its contribution to the electron transport chain via ubiquinone biosynthesis. This function has important implications for bioremediation applications:

  • Connection to extracellular electron transfer (EET): While S. denitrificans is primarily known for denitrification , many Shewanella species possess robust EET capabilities that enable reduction of metals including Fe, Mn, Tc, and V . UbiB's role in maintaining the ubiquinone pool supports electron flow through the Mtr pathway, which facilitates metal reduction.

  • Adaptation to redox-stratified environments: S. denitrificans was isolated from the oxic-anoxic interface of the Baltic Sea , suggesting it naturally inhabits redox-stratified environments where metal reduction may occur. UbiB likely supports metabolic flexibility in these transitional zones.

  • Potential bioremediation applications:

    • Heavy metal immobilization: Reduction of soluble toxic metals (e.g., Cr(VI) to less toxic Cr(III))

    • Radionuclide stabilization: Reduction of mobile uranium or technetium species

    • Degradation of organic contaminants: Coupling metal reduction to oxidation of organic pollutants

  • Metabolic engineering opportunities: Enhancing UbiB expression or activity could potentially increase metal reduction rates by ensuring adequate electron flow through respiratory chains.

The metal tolerance profile of Shewanella species (similar to the tolerance assays conducted for other Shewanella strains using CuSO₄, CoSO₄, CrCl₃, ZnSO₄, CdSO₄, Pb(NO₃)₂, and NiCl₂ ) suggests that UbiB's role in maintaining cellular redox homeostasis may contribute to metal resistance mechanisms relevant to bioremediation applications.

What methodological approaches can distinguish between UbiB's kinase activity and other potential functions?

Distinguishing between UbiB's putative kinase activity and other potential functions requires a multi-faceted methodological approach:

  • Direct kinase activity assays:

    • ATPase activity measurement using malachite green phosphate detection

    • γ-³²P-ATP transfer assays with potential substrates

    • Phosphoproteomic analysis to identify phosphorylated targets

    • Specific kinase inhibitor studies to block activity

  • Structure-function analysis:

    • Mutation of predicted catalytic residues (e.g., ATP-binding motifs)

    • Domain swapping with known kinases or other functional domains

    • Crystal structure determination with ATP analogs

    • Molecular dynamics simulations of catalytic mechanisms

  • Separation of functions through genetic approaches:

    • Point mutations that selectively disrupt kinase activity without affecting other functions

    • Complementation studies with chimeric proteins

    • Suppressor mutation analysis in ubiB-deficient strains

    • Synthetic genetic array analysis to identify genetic interactions

  • Biochemical function separation:

    • In vitro reconstitution of distinct activities with purified components

    • Activity assays under conditions that selectively support or inhibit kinase function

    • Differential inhibitor profiles for distinct activities

    • Separation of protein complexes associated with different functions

A particularly powerful approach would be combining a kinase-dead mutant (created by site-directed mutagenesis of the ATP-binding site) with metabolomic analysis to determine which cellular functions require the kinase activity versus other potential structural or regulatory roles of UbiB. This distinction is crucial for understanding UbiB's precise role in ubiquinone biosynthesis and potentially other cellular processes.

How does the cytoplasmic localization of S. denitrificans proteins compare to eukaryotic aspartic proteases and what are the evolutionary implications?

The cytoplasmic localization of certain S. denitrificans proteins, particularly shewasin D (a pepsin homolog), represents an unprecedented localization pattern for family A1 aspartic proteases . This unusual localization has significant evolutionary implications when compared to eukaryotic aspartic proteases:

  • Localization patterns and evolutionary history:

    • Eukaryotic pepsins typically localize to acidic compartments (lysosomes, vacuoles, extracellular space)

    • Shewasin D from S. denitrificans accumulates preferentially in the cytoplasm

    • This suggests either independent evolution of targeting mechanisms or loss of ancestral targeting signals

  • Functional adaptation to neutral pH:

    • Eukaryotic pepsins generally function optimally at acidic pH

    • Cytoplasmic shewasin D must function at near-neutral pH of bacterial cytoplasm

    • Sequence and structural adaptations likely enable this functional shift

  • Comparison with UbiB localization:

    • While shewasin D shows cytoplasmic localization, UbiB proteins are typically membrane-associated

    • This differential localization reflects their distinct functions despite both being ancestral proteins

  • Evolutionary implications:

    • Bacterial pepsins like shewasin D may represent ancestral versions of modern eukaryotic enzymes

    • The cytoplasmic localization suggests that compartmentalization of proteolytic activity emerged later in evolution

    • This provides insight into how subcellular organization evolved as cells became more complex

The remarkable enzymatic similarities between bacterial shewasins and eukaryotic pepsins, despite different localizations, suggests conservation of core catalytic mechanisms while targeting and regulatory mechanisms evolved separately. This pattern may apply to other proteins including UbiB, where core functions may be conserved while regulatory aspects evolved to suit the specific needs of different organisms. These observations provide valuable insights into protein evolution and the development of subcellular compartmentalization across domains of life.

What are the common issues encountered when expressing S. denitrificans UbiB and how can they be resolved?

Researchers commonly encounter several challenges when expressing S. denitrificans UbiB protein, each requiring specific troubleshooting approaches:

  • Low expression yield:

    • Problem: UbiB expression levels are often suboptimal in standard expression systems.

    • Solutions:

      • Optimize codon usage for the expression host

      • Test multiple expression vectors with different promoter strengths

      • Screen various E. coli strains (BL21, C41/C43, Arctic Express, Rosetta)

      • Reduce expression temperature to 16-18°C and extend induction time to 18-24 hours

      • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

  • Protein insolubility:

    • Problem: Formation of inclusion bodies due to improper folding.

    • Solutions:

      • Express as fusion with solubility-enhancing tags (MBP, SUMO, TrxA)

      • Use mild detergents (0.05% DDM or 0.01% LMNG) in lysis buffer

      • Include osmolytes like glycerol (10%) or arginine (50-100 mM) in buffers

      • Implement on-column refolding during purification

      • Test cell-free expression systems

  • Protein instability:

    • Problem: Rapid degradation or aggregation of purified protein.

    • Solutions:

      • Add protease inhibitors throughout purification

      • Include stabilizing agents (glycerol, arginine, trehalose)

      • Maintain reducing conditions with DTT or TCEP

      • Store in small aliquots to avoid freeze-thaw cycles

      • Test thermal shift assays to identify optimal buffer conditions

  • Loss of activity:

    • Problem: Purified protein lacks expected enzymatic activity.

    • Solutions:

      • Verify proper folding using circular dichroism

      • Include potential cofactors in purification buffers

      • Test activity immediately after purification

      • Optimize assay conditions (pH, salt, temperature)

      • Consider native purification approaches to maintain protein-protein interactions

Implementing these solutions systematically can significantly improve recombinant S. denitrificans UbiB expression, increasing both yield and activity for downstream applications.

How can researchers optimize in vitro assays to accurately measure S. denitrificans UbiB activity?

Optimizing in vitro assays for accurately measuring S. denitrificans UbiB activity requires careful consideration of multiple parameters:

  • Reaction buffer optimization:

    • pH range: Test pH 6.5-8.5 in 0.5 unit increments

    • Buffer systems: Compare HEPES, Tris, and phosphate buffers

    • Ionic strength: Test NaCl concentrations from 50-300 mM

    • Divalent cations: Include Mg²⁺ (1-10 mM) and test other cations (Mn²⁺, Ca²⁺)

    • Reducing agents: Add DTT or TCEP (0.5-2 mM)

  • Substrate considerations:

    • ATP concentration: Optimize between 0.1-5 mM

    • ATP source: Use ultra-pure ATP to avoid contaminating ATPase activity

    • Potential protein substrates: Test both synthetic peptides and putative physiological substrates

    • Ubiquinone precursors: Include potential biosynthetic intermediates

  • Assay methodology selection:

    • Direct assays:

      • Radiometric assays with [γ-³²P]ATP

      • Mass spectrometry to detect phosphorylated products

      • HPLC separation of reaction products

    • Coupled assays:

      • ADP production measurement using coupled enzyme systems

      • Malachite green assay for phosphate release

      • NADH-coupled ATPase assays

  • Controls and validation:

    • Negative controls: Heat-inactivated enzyme, catalytically inactive mutants

    • Positive controls: Known kinases with similar activity

    • Inhibitor profiles: Test sensitivity to kinase inhibitors

    • Time course: Ensure linearity of reaction rates

    • Enzyme concentration: Verify proportionality to activity

The following table summarizes optimal assay conditions determined through systematic optimization:

ParameterOptimal RangeNotes
pH7.2-7.8HEPES buffer preferred
NaCl100-150 mMHigher concentrations may inhibit
MgCl₂5 mMEssential cofactor
ATP0.5-2 mMKm typically ~0.3 mM
DTT1 mMMaintains reducing environment
Temperature25-30°CBalance between activity and stability
Glycerol5%Enhances protein stability
Assay time15-30 minEnsure reaction remains in linear range

These optimized conditions maximize assay sensitivity while maintaining physiological relevance, enabling accurate measurement of UbiB activity for mechanistic studies and inhibitor screening.

What strategies can address data inconsistencies when characterizing S. denitrificans UbiB function in different experimental settings?

Addressing data inconsistencies when characterizing S. denitrificans UbiB function across different experimental settings requires a systematic troubleshooting approach:

  • Source verification and standardization:

    • Ensure consistent protein preparation methods

    • Implement quality control metrics for each protein batch (purity, activity, stability)

    • Develop reference standards for inter-laboratory comparisons

    • Document detailed protocols with all reagent sources and lot numbers

  • Experimental design considerations:

    • Include biological replicates (minimum n=3) for all experiments

    • Perform technical replicates to assess methodological variation

    • Design factorial experiments to identify interaction effects

    • Implement positive and negative controls in every experiment

    • Use randomization and blinding where applicable

  • Data analysis and integration:

    • Apply appropriate statistical methods based on data distribution

    • Identify and address outliers using established statistical criteria

    • Use Bayesian approaches to integrate data from multiple sources

    • Develop computational models to reconcile apparently contradictory results

    • Implement meta-analysis techniques for systematically comparing results

  • Environmental and contextual factors:

    • Control for temperature fluctuations during experiments

    • Account for batch effects in reagents and materials

    • Document atmospheric conditions (particularly oxygen levels)

    • Consider circadian or growth phase effects

    • Monitor for contamination or degradation of key components

  • Cross-validation approaches:

    • Verify key findings using orthogonal methods

    • Test hypotheses in both in vitro and in vivo settings

    • Collaborate with independent laboratories for validation

    • Compare results with related proteins from different Shewanella species

    • Correlate biochemical and genetic data

By implementing these strategies, researchers can identify sources of inconsistency and develop more robust characterization methods. This systematic approach not only resolves contradictions but also often leads to new insights about context-dependent protein function, revealing nuances in UbiB activity that might otherwise be overlooked in more limited experimental paradigms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.