Recombinant Shewanella denitrificans Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
htpX; Sden_2130; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Target Names
htpX
Target Protein Sequence
MKRVFLLIATNLAILLVASIVMSILGVNTSTMGGLLVFAAIFGFGGSFISLAISKWMAKK TMGCEVIVQPRDETERWLVDTVTRQAKQAGINMPEVAIYQSPEMNAFATGPSKNNALVAV STGLLYGMTRDEIEGVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIIDNFVSS NDEEGQGLGMFAYMGVVFVLDMLFGILASIIVAYFSRIREFKADEGAARLAGKDKMIAAL ERLRAGPESGAMPAQMSAFGINGKRSMADFMMSHPPLEKRIAALKNS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular classification of HtpX and what cellular location does it occupy?

HtpX from Shewanella denitrificans belongs to the M48 family of zinc metalloproteinases. Similar to its well-studied homolog in Escherichia coli, it is localized in the cytoplasmic membrane where it plays a crucial role in membrane protein quality control . As a membrane-integrated protease, HtpX contains multiple transmembrane domains that anchor it within the lipid bilayer, allowing it to access and cleave misfolded or damaged membrane proteins.

How does S. denitrificans differ from other Shewanella species?

Shewanella denitrificans is a distinctive member of the Shewanella genus, isolated from the oxic-anoxic interface of an anoxic basin in the central Baltic Sea. Phylogenetic analyses based on 16S rDNA sequences show clear affiliation with the gamma-Proteobacteria, with closest sequence similarity to Shewanella baltica, Shewanella putrefaciens, and Shewanella frigidimarina (95-96%) . Unlike many other Shewanella species, S. denitrificans is characterized by its vigorous denitrification capabilities, being able to use nitrate, nitrite, and sulphite as electron acceptors under anaerobic conditions . The bacterium is unpigmented, polarly flagellated, mesophilic, and facultatively anaerobic, with growth observed at salinities ranging from 0 to 6% (optimum between 1-3%) .

What is the fatty acid profile and genomic composition of S. denitrificans?

The dominant fatty acids in S. denitrificans include 16:1ω7c, 15:0 iso, 16:0, and 13:0 iso, which constitute its characteristic membrane composition . The G+C content of the DNA ranges from 46.8 to 48.1 mol% . This genomic profile differs slightly from other Shewanella species and contributes to its adaptation to the estuarine environment.

What approaches can be used to develop an in vivo protease activity assay for HtpX?

Developing an effective in vivo protease activity assay for HtpX requires creating suitable model substrates. Based on methodologies used for E. coli HtpX, researchers can construct a new model substrate that allows sensitive detection of protease activity. An effective approach involves:

  • Designing fusion proteins containing domains recognizable by HtpX

  • Incorporating reporter elements (fluorescent or colorimetric) that change upon proteolytic cleavage

  • Establishing a semiquantitative measurement system to detect differential protease activities

This methodology enables detection of varying protease activities among HtpX mutants with alterations in conserved regions, providing valuable insights into structure-function relationships . The assay can be applied not only to S. denitrificans HtpX but also to homologs in other bacteria, facilitating comparative studies.

How can recombinant HtpX be expressed and purified effectively?

Expression and purification of recombinant membrane proteins like HtpX present significant challenges. A methodical approach includes:

  • Vector selection: Using plasmid systems with appropriate copy numbers. Based on studies with Shewanella oneidensis, replicons with moderate copy numbers (such as p15A with approximately 33 copies per cell) often provide optimal expression for membrane proteins, balancing protein yield with reduced cellular stress .

  • Promoter optimization: Testing various promoter strengths to achieve the desired expression level. The pTrc promoter system has been successfully used in Shewanella species .

  • Host strain selection: For heterologous expression, E. coli strains designed for membrane protein expression (such as C41/C43) can be used, while homologous expression in Shewanella requires optimized growth conditions.

  • Purification strategy: A two-step approach using affinity chromatography (His-tag) followed by size exclusion chromatography in the presence of appropriate detergents (DDM, LDAO) to maintain protein stability and activity.

The table below summarizes replicon options for expression in Shewanella:

RepliconCopy NumberRelative Expression LevelSuitability for Membrane Proteins
CoIE54Very highLimited (potential toxicity)
pSC10140HighModerate
p15A33ModerateGood
pBBR123Low to moderateExcellent

Data derived from real-time quantitative PCR measurements in Shewanella species .

What techniques are most effective for studying the structural properties of membrane-bound HtpX?

Determining the structure of membrane proteases presents unique challenges. For HtpX, researchers should consider:

  • Cryo-electron microscopy (cryo-EM): Particularly suitable for membrane proteins as it allows visualization in a near-native environment with minimal sample preparation that might disrupt membrane integrity.

  • X-ray crystallography: Requires detergent-solubilized protein and often benefits from antibody fragment co-crystallization to provide crystal contacts for these hydrophobic proteins.

  • NMR spectroscopy: Solution NMR can be used for studying dynamics and ligand interactions of detergent-solubilized domains, while solid-state NMR is applicable to membrane-embedded HtpX.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Valuable for mapping solvent-accessible regions and conformational changes upon substrate binding.

  • Molecular dynamics simulations: Complementary to experimental approaches, providing insights into dynamic behavior within the membrane environment.

How can the catalytic mechanism of HtpX be investigated?

As an M48 family zinc metalloproteinase, HtpX likely employs a metal-dependent hydrolysis mechanism. Investigating this mechanism requires:

  • Site-directed mutagenesis: Systematically altering conserved residues in the predicted active site, particularly the zinc-binding HEXXH motif common to metalloproteinases.

  • Metal dependency assays: Testing activity in the presence of various metal ions and chelators to confirm the role of zinc.

  • Proteolytic activity assays: Using the in vivo assay system described earlier to quantify the effects of mutations on catalytic efficiency .

  • Identification of natural substrates: Employing techniques such as SILAC (Stable Isotope Labeling with Amino acids in Cell culture) combined with mass spectrometry to identify physiological substrates in S. denitrificans.

What is known about the biological function of HtpX in bacterial membrane protein quality control?

HtpX plays a crucial role in membrane protein quality control, particularly under stress conditions. Based on studies in related systems:

  • HtpX functions as a secondary protease in the degradation of misfolded membrane proteins, often working in conjunction with other proteases like FtsH.

  • It is particularly important during heat stress (hence the "Htp" designation for heat shock protein), helping to remove damaged membrane proteins that could compromise cellular integrity.

  • The protein likely recognizes specific structural features or degrons exposed in misfolded membrane proteins, rather than specific amino acid sequences.

  • Its activity complements other quality control mechanisms, forming part of an integrated network that maintains membrane proteostasis.

How is HtpX expression regulated in response to environmental stressors?

Although specific data for S. denitrificans HtpX regulation is limited, insights from related bacterial systems suggest:

  • Transcriptional regulation likely involves stress-responsive sigma factors (such as σ^32 or σ^E in E. coli) that recognize promoters of stress-response genes.

  • Expression may be upregulated in response to conditions that cause membrane protein misfolding, including heat shock, oxidative stress, and exposure to membrane-disrupting compounds.

  • Post-translational regulation may occur through proteolytic activation or cofactor binding, allowing rapid response to changing conditions.

  • The regulation may be integrated with other stress response pathways, creating a coordinated cellular response to environmental challenges.

How can model substrates be designed to study HtpX specificity and activity?

Designing effective model substrates requires understanding both the enzyme mechanism and practical detection considerations:

  • Fusion protein approach: Construct chimeric proteins containing:

    • A domain recognized by HtpX (ideally derived from a known substrate)

    • A reporter element (such as GFP or luciferase) whose activity or localization changes upon cleavage

    • Appropriate linkers that do not interfere with folding or recognition

  • Cleavage site identification: Use mass spectrometry and N-terminal sequencing to precisely map the cleavage sites, allowing refinement of substrate design.

  • Quantification system: Develop methods to accurately measure cleavage rates, potentially using fluorescence or luminescence-based assays that provide real-time data.

This approach has been successfully implemented for E. coli HtpX, yielding a semiquantitative and convenient protease activity assay that can detect differences in activity among HtpX variants .

What genetic manipulation techniques are most suitable for studying HtpX function in Shewanella denitrificans?

Based on genetic tools developed for related Shewanella species, researchers can employ:

  • Plasmid-based expression systems: Utilizing the synthetic plasmid toolkit approach with various components:

    • Replicons of different copy numbers (pBBR1, p15A, pSC101, CoIE)

    • Promoters of various strengths for fine-tuned expression

    • Antibiotic resistance markers for selection

    • RK2 origin of transfer (oriT) for conjugative transfer

  • Gene deletion strategies: Creation of knockout strains using homologous recombination or CRISPR-Cas9 based methods to study the effects of HtpX absence.

  • Complementation assays: Reintroduction of wild-type or mutated htpX genes into knockout strains to assess functional recovery.

  • Reporter gene fusions: Creation of transcriptional or translational fusions to monitor expression patterns under various conditions.

How does S. denitrificans HtpX compare to homologous proteases in other bacterial species?

Comparative analysis of HtpX across bacterial species reveals important evolutionary relationships and functional adaptations:

  • Sequence conservation: The catalytic domain, particularly the zinc-binding motif, shows high conservation across species, underlining its fundamental importance to protease function.

  • Structural variations: Differences in transmembrane domains and regulatory regions may reflect adaptations to specific membrane compositions or environmental conditions.

  • Functional equivalence: Cross-complementation studies with HtpX from different species can reveal the degree of functional conservation and species-specific adaptations.

  • Co-evolution with substrates: Analysis of potential substrate conservation across species may provide insights into the evolutionary history of this quality control system.

What insights can S. denitrificans HtpX provide about adaptation to environmental stress?

As a bacterium isolated from the oxic-anoxic interface in the Baltic Sea, S. denitrificans has adapted to a challenging environment with fluctuating oxygen levels. The role of HtpX in this context may include:

  • Adaptation to oxygen fluctuations: Potential involvement in remodeling the membrane proteome during transitions between aerobic and anaerobic metabolism.

  • Response to salinity changes: Given the growth of S. denitrificans at salinities from 0-6% , HtpX may participate in maintaining membrane integrity during osmotic stress.

  • Temperature adaptation: As a mesophilic organism, S. denitrificans faces seasonal temperature variations, and HtpX likely contributes to membrane protein quality control during thermal stress.

  • Integration with denitrification pathways: Potential coordination between HtpX activity and the expression of denitrification enzymes during transitions between electron acceptors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.