Recombinant Shewanella denitrificans UPF0114 protein Sden_0436 (Sden_0436)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Sden_0436; UPF0114 protein Sden_0436
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Target Names
Sden_0436
Target Protein Sequence
MEKVFEKLMYASRWIMAPIYLGLSLILFALGIKFFQEIFHLIPNIFEIAEVDLVLITLSL IDITLVGGLLIMVMFSGYENFVSQLDVGESSEKLNWLGKMDAGSLKNKVAASIVAISSIH LLKVFMNAENIANDKIMWYLLIHITFVLSAFAMGYLDKITRK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is UPF0114 protein Sden_0436 and what organism does it come from?

UPF0114 protein Sden_0436 is a protein encoded by the Sden_0436 gene in Shewanella denitrificans strain OS217 (also designated as ATCC BAA-1090 or DSM 15013). The "UPF" designation stands for "Uncharacterized Protein Family," indicating its function is not yet fully characterized. It's a full-length protein of 162 amino acids with the UniProt accession number Q12S48 . Shewanella denitrificans is a gram-negative, rod-shaped, motile bacterium isolated from the oxic-anoxic interface of an anoxic basin in the central Baltic Sea at a depth of 130 meters .

What are the key characteristics of Shewanella denitrificans as a model organism?

Shewanella denitrificans possesses several distinguishing characteristics that make it an interesting model organism:

  • Gram-negative, rod-shaped bacterium with polar flagella

  • Obligate aerobe (requires oxygen), unlike many other Shewanella species

  • Capable of vigorous denitrification (using nitrate, nitrite, and sulphite as electron acceptors)

  • Mesophilic with growth observed at salinities from 0 to 6% (optimal growth between 1-3%)

  • Phylogenetically belongs to gamma-Proteobacteria with genomic G+C content ranging from 46.8 to 48.1 mol%

  • Closest sequence similarity (95-96%) with Shewanella baltica, Shewanella putrefaciens, and Shewanella frigidimarina

What expression systems are optimal for recombinant production of Sden_0436?

The choice of expression system depends on research objectives and protein requirements:

Expression SystemAdvantagesLimitationsRecommended Use
E. coliHigh yield, shorter turnaround times, cost-effectiveLimited post-translational modificationsStructural studies, antibody production
YeastGood yields, some post-translational modificationsMore complex than E. coliFunctional studies requiring some modifications
Insect cells with baculovirusMany post-translational modifications, proper foldingLower yields, more time-consumingStudies requiring authentic protein folding
Mammalian cellsMost authentic post-translational modificationsLowest yields, most expensiveStudies requiring native activity

What are the optimal storage conditions for maintaining recombinant UPF0114 protein Sden_0436 stability?

For maximum stability of recombinant UPF0114 protein Sden_0436, the following storage conditions are recommended:

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized for this specific protein

  • Short-term storage: -20°C

  • Extended storage: -20°C or -80°C (preferably -80°C for long-term preservation)

  • Working aliquots: Store at 4°C for up to one week

  • Important note: Repeated freezing and thawing should be avoided to maintain protein integrity

The shelf life of liquid preparations is typically 6 months at -20°C/-80°C, while lyophilized forms can remain stable for up to 12 months at -20°C/-80°C .

What research methodologies are most appropriate for investigating the function of UPF0114 protein Sden_0436?

Given that UPF0114 protein Sden_0436 is part of an uncharacterized protein family, a mixed-method research approach is recommended:

Research Design Options:

  • Quantitative Approach:

    • Protein-protein interaction quantification

    • Enzyme kinetics measurements (if enzymatic activity is discovered)

    • Differential expression analysis under various conditions

    • Structural analysis through X-ray crystallography or cryo-EM

  • Qualitative Approach:

    • Phenotypic analysis of gene knockout strains

    • Localization studies using fluorescence microscopy

    • Protein interaction network mapping

    • Functional complementation assays

  • Mixed Methods Approach (Recommended):

    • Bioinformatic analysis to generate functional hypotheses

    • Experimental validation using both quantitative and qualitative methods

    • Iterative hypothesis refinement based on initial findings3

The research methodology should be structured as a plan to answer specific research questions about Sden_0436 function, employing appropriate methods to implement that plan .

How can comparative genomics approaches elucidate the evolutionary conservation and potential function of UPF0114 protein Sden_0436?

Comparative genomics provides a powerful framework for understanding UPF0114 protein Sden_0436 through evolutionary analysis:

  • Synteny Analysis:

    • Examine gene neighborhoods around Sden_0436 orthologs across Shewanella species

    • Conserved synteny often indicates functional relationships between genes

    • This approach has successfully identified genes underlying cold tolerance and other phenotypes in Shewanella species

  • Ortholog Identification and Phylogenetic Analysis:

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Calculate selection pressures (dN/dS ratios) to identify conserved functional domains

    • Map presence/absence of orthologs to species phenotypes

  • Correlation with Ecological Adaptations:

    • Compare sequence conservation with the ecological characteristics of different Shewanella species

    • Test for correlation between specific amino acid changes and adaptation to particular environments

    • Shewanella species occupy diverse niches from deep-sea to freshwater environments, providing natural evolutionary experiments

This approach leverages evolutionary conservation patterns to generate testable hypotheses about protein function, particularly valuable for uncharacterized protein families.

What experimental approaches are most suitable for investigating the potential role of UPF0114 protein Sden_0436 in denitrification pathways?

Given that Shewanella denitrificans is characterized by vigorous denitrification capabilities , investigating whether UPF0114 protein Sden_0436 plays a role in this process requires a systematic experimental approach:

  • Gene Expression Analysis:

    • qRT-PCR to measure Sden_0436 expression under aerobic vs. denitrifying conditions

    • RNA-seq to identify co-regulated genes in the denitrification pathway

    • Promoter-reporter fusion assays to visualize expression patterns

  • Gene Disruption Studies:

    • Create knockout or knockdown strains of Sden_0436

    • Assess denitrification activity by measuring N₂O and N₂ production

    • Compare nitrate, nitrite, and nitric oxide reduction rates between wild-type and mutant strains

  • Biochemical Characterization:

    • In vitro reconstitution experiments with purified components

    • Electron transfer measurements to determine if Sden_0436 participates in electron flow

    • Protein-protein interaction studies with known denitrification enzymes

  • Physiological Characterization:

    • Growth curve analysis under different electron acceptor conditions

    • Measurement of cellular redox state in wild-type vs. mutant strains

    • Adaptation responses to shifts between aerobic and anaerobic conditions

This multi-faceted approach can establish whether Sden_0436 has a direct role in denitrification or contributes indirectly to this important metabolic process in Shewanella denitrificans.

What are the best methodologies for studying the structure-function relationship of UPF0114 protein Sden_0436?

Elucidating the structure-function relationship of UPF0114 protein Sden_0436 requires an integrated approach:

  • Structural Determination Methods:

    • X-ray crystallography for high-resolution static structure

    • NMR spectroscopy for solution structure and dynamics (suitable for a 162 amino acid protein)

    • Cryo-EM if the protein forms larger complexes

    • Computational prediction using AlphaFold or similar tools as a starting point

  • Functional Mapping Strategies:

    • Site-directed mutagenesis of conserved residues

    • Truncation analysis to identify functional domains

    • Chimeric proteins with homologs from other Shewanella species

    • Cross-linking studies to identify interaction interfaces

  • Structure-Function Correlation:

    • Map conservation data onto structural models

    • Molecular dynamics simulations to predict functional motions

    • Docking studies to identify potential binding partners or substrates

    • Structure-guided design of activity assays

This comprehensive approach connects structural features to functional properties, essential for understanding proteins of unknown function like UPF0114 protein Sden_0436.

How can researchers design experiments to investigate the potential membrane association of UPF0114 protein Sden_0436?

The amino acid sequence of UPF0114 protein Sden_0436 suggests potential membrane association. To investigate this hypothesis:

  • Membrane Localization Studies:

    • Subcellular fractionation followed by Western blotting

    • Fluorescent protein fusion (GFP/mCherry) for live-cell visualization

    • Immunogold electron microscopy for precise localization

    • Protease protection assays to determine topology

  • Membrane Interaction Analysis:

    • Liposome binding assays with varied lipid compositions

    • Membrane extraction using detergents of different strengths

    • Fluorescence anisotropy to measure direct lipid binding

    • Monolayer insertion experiments

  • Functional Assessment:

    • Test for ion channel or transporter activity in reconstituted systems

    • Assess effects on membrane integrity in knockout strains

    • Investigate co-localization with known membrane protein complexes

    • Measure membrane properties in presence/absence of the protein

This methodological framework allows for comprehensive testing of membrane association hypotheses and potential membrane-related functions of UPF0114 protein Sden_0436.

What proteomics approaches can reveal the role of UPF0114 protein Sden_0436 in cellular networks?

Proteomics offers powerful tools for placing UPF0114 protein Sden_0436 within its cellular context:

  • Interaction Proteomics:

    • Immunoprecipitation coupled with mass spectrometry

    • Proximity-dependent biotin labeling (BioID or APEX)

    • Chemical cross-linking mass spectrometry

    • These approaches have successfully identified protein networks in Shewanella species

  • Differential Expression Analysis:

    • Compare proteome profiles between wild-type and Sden_0436 knockout strains

    • SILAC or TMT labeling for quantitative comparisons

    • Analysis under different environmental conditions relevant to Shewanella denitrificans ecology

  • Post-translational Modification Mapping:

    • Phosphoproteomics to identify regulatory phosphorylation

    • Analysis of other PTMs relevant to bacterial signaling

    • Dynamic changes in PTMs under different growth conditions

  • Structural Proteomics:

    • Limited proteolysis coupled with mass spectrometry

    • Hydrogen-deuterium exchange mass spectrometry

    • In-cell cross-linking to capture native interactions

These approaches together can reveal functional associations, regulatory mechanisms, and physiological contexts for UPF0114 protein Sden_0436 even without prior knowledge of its specific biochemical function.

How should researchers design and interpret control experiments when studying UPF0114 protein Sden_0436 function?

Robust control experiments are essential when investigating an uncharacterized protein like UPF0114 protein Sden_0436:

  • Genetic Controls:

    • Clean deletion mutants with confirmed genotype

    • Complementation with wild-type gene to verify phenotype restoration

    • Point mutants of conserved residues as functional controls

    • Use of multiple independent knockout clones to ensure reproducibility

  • Protein Expression Controls:

    • Empty vector controls for expression systems

    • Tag-only controls to distinguish tag effects from protein effects

    • Inactive mutant versions (if active sites are identified)

    • Denatured protein controls for binding specificity

  • Experimental Design Controls:

    • Time course experiments to capture dynamic responses

    • Dose-response relationships to establish specificity

    • Multiple environmental parameters tested independently and in combination

    • Technical and biological replicates with appropriate statistical analysis

  • Analytical Framework:

    • Use multiple detection methods to confirm observations

    • Apply appropriate statistical tests based on experimental design

    • Consider effect size calculation beyond statistical significance

    • Evaluate alternative hypotheses for observed phenotypes

Proper controls not only validate findings but also help distinguish direct effects of UPF0114 protein Sden_0436 from indirect consequences or experimental artifacts, which is especially important when working with proteins of unknown function.

What methodological frameworks help resolve contradictory data when studying novel proteins like UPF0114 protein Sden_0436?

When investigating novel proteins like UPF0114 protein Sden_0436, contradictory results are common. The following methodological framework helps resolve such inconsistencies:

  • Systematic Error Identification:

    • Examine differences in experimental conditions

    • Verify reagent quality and specificity

    • Assess potential contamination or degradation issues

    • Consider strain or construct differences

  • Multi-method Validation:

    • Employ orthogonal techniques to test the same hypothesis

    • Compare in vitro versus in vivo approaches

    • Use both genetic and biochemical methods

    • Apply different analytical platforms

  • Contextual Analysis:

    • Consider environmental or growth condition differences

    • Examine temporal aspects (growth phase, induction time)

    • Assess genetic background effects

    • Evaluate media composition differences

  • Statistical Rigor:

    • Increase sample size to improve statistical power

    • Apply appropriate statistical tests for the data type

    • Use meta-analysis techniques to integrate multiple datasets

    • Conduct sensitivity analysis to identify influential variables

This structured approach helps identify the source of contradictions and develop a unified understanding of UPF0114 protein Sden_0436 function despite initially conflicting data.

How can researchers effectively analyze the relationship between methodology and research questions when studying UPF0114 protein Sden_0436?

The relationship between research methodology and research questions is critical for effective investigation of UPF0114 protein Sden_0436:

  • Methodology-Question Alignment:

    • Quantitative methodologies are appropriate for questions about protein amounts, binding affinities, or kinetic parameters

    • Qualitative methodologies better address questions about cellular localization, interaction networks, or phenotypic effects

    • Mixed methods are ideal for complex questions about biological function

  • Research Question Formulation:

    • Correlational questions: "What is the relationship between UPF0114 protein Sden_0436 expression and denitrification rates?"

    • Exploratory questions: "Does UPF0114 protein Sden_0436 interact with the cell membrane?"

    • Explanatory questions: "What mechanism does UPF0114 protein Sden_0436 use to affect cell physiology?"

  • Methodological Evaluation:

    • Consider how methodology selection impacts data interpretation

    • Evaluate if the chosen method adequately addresses all aspects of the research question

    • Assess potential methodological biases in the research approach

    • Determine if alternative methodologies could provide complementary insights3

As noted in research methodology literature, "research design is a plan to answer your research question. A research method is a strategy used to implement that plan." This distinction is crucial when studying novel proteins like UPF0114 protein Sden_0436, where the most appropriate methods may not be immediately obvious.

How might UPF0114 protein Sden_0436 research contribute to understanding Shewanella infections in humans?

Although primarily a basic research subject, studying UPF0114 protein Sden_0436 may have relevance to medical microbiology:

  • Clinical Context of Shewanella Infections:

    • Shewanella species cause opportunistic infections in humans, with S. algae and S. putrefaciens being the most common clinical isolates

    • Infections occur primarily in individuals with underlying conditions (79% of cases)

    • Common presentations include soft tissue infections, ear infections, and abdominal/biliary tract infections

    • Most patients (87%) recover, but fatality occurs in 13% of cases

  • Research Approaches with Clinical Relevance:

    • Comparative analysis of UPF0114 protein homologs across pathogenic and non-pathogenic Shewanella species

    • Investigation of UPF0114 protein Sden_0436 in stress response and survival under host conditions

    • Assessment of potential contribution to antimicrobial resistance mechanisms

    • Evaluation as a potential diagnostic or therapeutic target

  • Methodological Considerations:

    • Use of clinical isolates in comparative studies

    • Development of infection models to test hypotheses

    • Collaboration with clinical researchers for translational aspects

    • Ethical considerations in research design

While Shewanella denitrificans itself is not a significant human pathogen, insights from studying UPF0114 protein Sden_0436 could potentially inform our understanding of related proteins in clinically relevant Shewanella species .

What emerging techniques might enhance future studies of UPF0114 protein Sden_0436?

Emerging research technologies offer new avenues for investigating UPF0114 protein Sden_0436:

  • Advanced Structural Biology:

    • Cryo-electron tomography for in situ structural analysis

    • Integrative structural biology combining multiple data types

    • Time-resolved structural methods to capture conformational changes

    • AlphaFold and other AI tools for structure prediction and functional inference

  • Single-Cell Technologies:

    • Single-cell proteomics to capture cell-to-cell variation

    • Live-cell imaging with super-resolution microscopy

    • Single-molecule tracking to monitor protein dynamics

    • Correlative light and electron microscopy for precise localization

  • Genome Engineering:

    • CRISPR-Cas9 base editing for precise genetic modifications

    • CRISPRi/CRISPRa for conditional regulation

    • Multiplexed genome editing to assess genetic interactions

    • Synthetic genomics approaches to study minimal functional units

  • Systems Biology:

    • Multi-omics integration for comprehensive cellular context

    • Machine learning for pattern recognition in complex datasets

    • Metabolic flux analysis to connect protein function to cellular metabolism

    • Computational modeling to predict system-level effects

These emerging technologies can provide unprecedented insights into UPF0114 protein Sden_0436 function, potentially revealing its role within the broader cellular and ecological context of Shewanella denitrificans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.