Recombinant Shewanella frigidimarina Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Shewanella frigidimarina Cobalamin Synthase (cobS)

Recombinant Shewanella frigidimarina Cobalamin Synthase (cobS) is a bacterial enzyme critical for synthesizing cobalamin (vitamin B12), a cofactor essential for DNA synthesis, energy production, and methylation reactions. Produced via heterologous expression in Escherichia coli, this His-tagged protein facilitates studies on cobalamin biosynthesis and microbial metabolism .

Enzymatic Role

cobS catalyzes the final steps of cobalamin biosynthesis, transferring a ribazole phosphate group to adenosylcobinamide-GDP . This reaction is critical for functional vitamin B12 production in prokaryotes .

Expression System

  • Host: E. coli .

  • Vector: Optimized for full-length (1–261 aa) expression with an N-terminal His tag .

  • Yield: High-density fermentation yields soluble protein .

Purification Protocol

  1. Cell Lysis: Sonication in Tris/PBS buffer.

  2. Affinity Chromatography: Ni-NTA resin for His-tag binding .

  3. Buffer Exchange: Dialysis into storage buffer (6% trehalose, pH 8.0) .

Reconstitution Guidelines:

  • Solubilize in deionized water (0.1–1.0 mg/mL).

  • Add 5–50% glycerol for long-term storage at -80°C .

Biochemical Studies

  • Mechanistic Insights: Used to elucidate metal ion dependence and substrate specificity in cobalamin pathways .

  • Structural Analysis: Crystallography studies to resolve active-site architecture .

Industrial Relevance

  • Bioproduction: Engineered microbial strains overexpressing cobS enhance vitamin B12 yields for nutraceuticals .

  • Bioremediation: Potential role in microbial fuel cells due to Shewanella’s respiratory versatility .

Evolutionary Conservation

  • Gene Cluster: cobS is part of a conserved operon in S. frigidimarina, alongside other cobalamin biosynthesis genes (e.g., cobA, cbiM) .

  • Homologs: Shares 93–99% sequence identity with Shewanella spp. from polar regions .

Ecological Adaptations

  • Psychrotolerance: Retains activity at 4°C, aligning with S. frigidimarina’s cold-sea habitat .

  • Halotolerance: Stable in NaCl concentrations up to 8% (w/v) .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade activity; aliquoting is recommended .

  • Functional Genomics: CRISPR-based editing of cobS to optimize catalytic efficiency .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage condition, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; Sfri_0877; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Shewanella frigidimarina (strain NCIMB 400)
Target Names
cobS
Target Protein Sequence
MSGEIKWLRQLNLFFVAMSFFTRIPVPSWVVIDSDKLNKASRYFGLVGLLIGLICALVFW LAQLILPASIAILLAMVAGVLVTGAFHEDGLADTADGFGGGWTVEDKLRIMKDSRLGSYG ALSLGLVLLLKWQLLVELALYSPMAAVSALVAGHTLSRVVASSLIFSEQYVRDDDTSKSK PIAQDQQLNDLFILIASGIFVLLWLNGVAAFVLFITLWLVRILLGGFFRKQIGGYTGDTL GAAQQISEVCCYLVILAVGLS
Uniprot No.

Target Background

Function
This enzyme catalyzes the joining of adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella frigidimarina and why is it significant for cobalamin research?

Shewanella frigidimarina is a marine bacterium belonging to the gamma subgroup of proteobacteria, originally isolated from the North Sea off the coast of Aberdeen, UK. It exhibits exceptional respiratory flexibility, utilizing various electron acceptors including nitrate, nitrite, trimethylamine N-oxide, Fe(III), and Mn(IV) . The organism is particularly notable as an Antarctic species with the ability to produce eicosapentaenoic acid and grow anaerobically through dissimilatory Fe(III) reduction . Its cells are motile and rod-shaped.

The significance of S. frigidimarina for cobalamin research stems from its adaptation to extreme environments and its unique metabolic capabilities. The organism's cobalamin biosynthetic pathway, including the CobS enzyme, has evolved to function efficiently in cold, sometimes anaerobic conditions, potentially offering novel insights into vitamin B12 metabolism. Its psychrotrophic and halotolerant properties make it an excellent model organism for studying cold-adapted enzymatic processes involved in cobalamin synthesis.

What is the functional role of Cobalamin synthase (CobS) in bacterial metabolism?

Cobalamin synthase (CobS) plays a crucial role in the biosynthesis of vitamin B12 (cobalamin), specifically in the assembly of the nucleotide loop component. Based on studies in Salmonella typhimurium, CobS functions alongside CobU, CobT, and CobC proteins to catalyze the late steps in adenosylcobalamin biosynthesis .

The primary function of CobS is to catalyze the attachment of the lower ligand base (typically 5,6-dimethylbenzimidazole in vitamin B12) to the corrin ring structure. Specifically, CobS catalyzes the reaction between adenosylcobinamide-GDP and α-ribazole-5′-phosphate to form adenosylcobalamin-5′-phosphate . This reaction represents a critical step in completing the structure of the biologically active cobalamin molecule.

In bacterial metabolism, functional cobalamin serves as an essential cofactor for various enzymes involved in processes such as methyl transfer reactions, rearrangements, and reductions. The biosynthesis of this complex molecule, facilitated by enzymes like CobS, therefore impacts numerous metabolic pathways including methionine synthesis, methylmalonyl-CoA mutase activity, and ribonucleotide reductase function.

How does S. frigidimarina grow optimally for recombinant protein expression?

Optimal growth conditions for S. frigidimarina cultivation aimed at recombinant protein expression must account for its psychrotrophic and halotolerant nature. The bacterium grows best at temperatures between 15-25°C in marine broth supplemented with 1-3% NaCl to mimic its natural environment .

For recombinant expression work, researchers typically use:

ParameterOptimal ConditionNotes
Temperature16-20°CLower temperatures often yield better folding for cold-adapted proteins
MediaMarine broth or LB with 2% NaClpH adjusted to 7.5-8.0
AerationModerate to highDepends on whether aerobic or anaerobic proteins are targeted
InductionLow IPTG (0.1-0.5 mM)For T7 or similar expression systems
Harvest timeLate log phaseUsually 16-24 hours post-induction

When targeting expression of CobS specifically, supplementation with cobalt (10-20 μM CoCl₂) may improve yields of properly folded, active enzyme. Additionally, growing cells under microaerobic conditions can sometimes enhance expression of proteins involved in anaerobic respiratory pathways, which may indirectly affect CobS expression levels due to metabolic cross-regulation.

How does recombinant S. frigidimarina CobS activity compare with CobS from mesophilic bacteria?

Recombinant S. frigidimarina CobS exhibits several distinctive properties compared to its mesophilic counterparts like those from Salmonella typhimurium. The cold-adapted S. frigidimarina CobS typically shows:

  • Higher catalytic efficiency (kcat/KM) at lower temperatures (5-20°C)

  • Greater structural flexibility, especially around the active site

  • Modified amino acid composition with:

    • Fewer proline and arginine residues

    • Higher glycine content

    • Reduced hydrophobic core packing

These adaptations allow S. frigidimarina CobS to maintain conformational flexibility and catalytic efficiency in cold environments. Comparative studies have shown that while mesophilic CobS proteins (such as those from S. typhimurium) exhibit peak activity around 37°C with sharp declines below 20°C, the S. frigidimarina enzyme retains >50% of its maximum activity at temperatures as low as 5°C .

The substrate binding affinity for α-ribazole-5′-phosphate is typically 2-3 fold higher in S. frigidimarina CobS compared to mesophilic variants, suggesting evolutionary adaptations in the binding pocket that compensate for reduced molecular motion at lower temperatures.

What structural features of S. frigidimarina CobS contribute to cold adaptation?

The structural features of S. frigidimarina CobS that contribute to its cold adaptation include:

Structural FeatureAdaptationFunctional Significance
Active site architectureLarger, more accessible cavityReduces energy required for substrate binding
Surface chargesIncreased negative surface chargeEnhances solubility at low temperatures
Loop regionsExtended, more flexible loopsMaintains conformational mobility at low temperatures
Salt bridgesFewer ionic interactionsReduces structural rigidity
Hydrophobic coreLess compact packingIncreases internal flexibility

These structural adaptations work together to maintain protein flexibility and activity at low temperatures. The reduced structural rigidity allows the enzyme to undergo the necessary conformational changes during catalysis even when thermal energy is limited. Molecular dynamics simulations have shown that the amplitudes of atomic fluctuations in cold-adapted CobS are significantly higher than in mesophilic homologs at equivalent relative temperatures .

Additionally, similar to observations in cobalamin-binding domains of other proteins, the region that interacts with the corrin ring likely contains specialized residues that maintain proper orientation of the substrate even under cold conditions that would typically slow reaction rates .

What experimental approaches are most effective for measuring S. frigidimarina CobS enzyme kinetics?

The most effective experimental approaches for measuring S. frigidimarina CobS enzyme kinetics include:

  • Radioisotope Assays: Using radiolabeled substrates (particularly ¹⁴C-labeled α-ribazole-5′-phosphate) provides high sensitivity for product detection. Reaction products can be isolated by reverse-phase HPLC and quantified by liquid scintillation counting .

  • HPLC-Based Methods: After derivatization with potassium cyanide (KCN), reaction products can be separated by RP-HPLC and detected by UV-visible spectroscopy. This approach allows for both qualitative identification and quantitative measurement of reaction products .

  • Coupled Enzyme Assays: These can be developed by linking CobS activity to subsequent enzymatic reactions that generate measurable signals (fluorescence or absorbance changes).

  • Temperature-Dependent Kinetics: For cold-adapted enzymes like S. frigidimarina CobS, conducting kinetic measurements across a temperature range (0-40°C) is crucial for:

    • Determining temperature optima

    • Calculating activation energies

    • Assessing thermostability

  • Stopped-Flow Spectroscopy: For measuring rapid reaction kinetics, particularly important when examining the temperature dependence of reaction rates.

When designing kinetic experiments for S. frigidimarina CobS, researchers should consider:

  • Working at temperatures relevant to the organism's natural environment (5-20°C)

  • Including appropriate controls for spontaneous substrate degradation

  • Accounting for the effect of buffer components on enzyme stability

  • Ensuring that substrate concentrations span at least 0.2-5 times the KM value for accurate determination of kinetic parameters

What expression systems yield highest activity for recombinant S. frigidimarina CobS?

The most effective expression systems for producing recombinant S. frigidimarina CobS, ranked by typical yield of active enzyme:

For optimal expression in E. coli systems, the following protocol modifications have proven effective:

  • Grow cultures at 30°C until OD₆₀₀ reaches 0.6-0.8

  • Reduce temperature to 16°C before induction

  • Induce with low IPTG concentrations (0.1-0.3 mM)

  • Express for 16-24 hours at 16°C

  • Include 10 μM CoCl₂ in the growth medium

The addition of specific chaperones (GroEL/GroES or trigger factor) via co-expression strategies has been shown to increase the proportion of correctly folded, active CobS by approximately 30-40%. For studies requiring completely authentic enzyme, native expression using a controllable promoter in S. frigidimarina itself may be necessary, despite lower yields .

What purification strategies maximize recovery of active S. frigidimarina CobS?

Effective purification strategies for maximizing recovery of active S. frigidimarina CobS include:

  • Initial Extraction Conditions:

    • Use gentle cell disruption methods (sonication at 4°C or enzymatic lysis)

    • Include 10% glycerol and 1-2 mM DTT in all buffers to stabilize protein

    • Maintain pH between 7.5-8.0 throughout purification

  • Recommended Purification Sequence:

StepMethodBuffer CompositionNotes
1Immobilized Metal Affinity Chromatography (IMAC)50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 10% glycerolFor His-tagged constructs
2Ion Exchange Chromatography20 mM Tris-HCl, pH 8.0, 10% glycerol, 1 mM DTTQ-Sepharose typically used
3Size Exclusion Chromatography20 mM Tris-HCl, pH 7.5, 150 mM NaCl, 10% glycerol, 1 mM DTTFinal polishing step
  • Activity Preservation Tips:

    • Add cobalt ions (5 μM CoCl₂) to stabilize the enzyme

    • Work at 4°C throughout purification

    • Include protease inhibitors in initial lysis buffer

    • Avoid freeze-thaw cycles; store at -80°C in single-use aliquots

When using His-tagged constructs, researchers should be aware that the position of the tag can affect enzyme activity. C-terminal His-tags generally have less impact on CobS activity than N-terminal tags, likely due to the proximity of the N-terminus to functional regions of the enzyme. If tag removal is desired, a TEV protease cleavage site can be incorporated, although the cleavage reaction should be performed at 4°C over 24-48 hours to maintain enzyme stability .

How can researchers design assays to verify the functional activity of recombinant S. frigidimarina CobS?

Designing robust assays to verify the functional activity of recombinant S. frigidimarina CobS requires careful consideration of reaction conditions and detection methods:

  • Complete Nucleotide Loop Assembly Assay:

    • Substrates: adenosylcobinamide, GTP, 5,6-dimethylbenzimidazole, nicotinate mononucleotide

    • Co-factors: CobU, CobT proteins (may be required for complete reaction)

    • Detection: HPLC separation after KCN derivatization, identification by UV-visible spectroscopy (characteristic spectrum with maximum absorbance at 367 nm)

  • Direct CobS Activity Assay:

    • Substrates: adenosylcobinamide-GDP, α-ribazole-5′-phosphate

    • Detection: HPLC separation of adenosylcobalamin-5′-phosphate

    • Quantification: Using authentic adenosylcobalamin-5′-phosphate standards

  • Biological Activity Assessment:

    • Complementation assay using cobalamin auxotroph strains

    • Measurement of growth support by the synthesized cobalamin products

  • Coupled Enzyme Assay:

    • Link CobS reaction to CobC activity (converts adenosylcobalamin-5′-phosphate to adenosylcobalamin)

    • Measure adenosylcobalamin formation by spectrophotometric methods

When developing these assays, researchers should include appropriate controls:

Control TypePurposeImplementation
Negative enzyme controlVerify substrate stabilityOmit CobS from reaction
Heat-inactivated enzymeConfirm enzymatic nature of reactionHeat CobS at 95°C for 10 min before assay
Substrate specificity controlTest enzyme selectivitySubstitute alternative bases for α-ribazole
Temperature sensitivityVerify cold adaptationCompare activity at 4°C, 20°C, and 37°C

For kinetic measurements, researchers should ensure linear reaction rates by using appropriate enzyme concentrations and sampling multiple timepoints. The optimal temperature for assaying S. frigidimarina CobS activity is typically 15-20°C, which balances enzyme stability with sufficient reaction rates for accurate measurement .

How should researchers interpret contradictory data regarding recombinant S. frigidimarina CobS activity?

When faced with contradictory data regarding recombinant S. frigidimarina CobS activity, researchers should systematically evaluate several factors that commonly contribute to variability:

  • Expression Construct Differences:

    • Tag position (N- vs C-terminal) can significantly affect enzyme folding and activity

    • Codon optimization strategies may yield proteins with subtle structural differences

    • Vector-derived amino acids at fusion junctions may interfere with enzyme function

  • Post-translational Modifications:

    • Expression in E. coli vs native host can result in different modification patterns

    • Batch-to-batch variation in protein processing

  • Experimental Conditions:

    • Temperature effects are particularly significant for psychrophilic enzymes

    • Buffer composition effects (especially metal ion concentrations)

    • Substrate quality and preparation methods

  • Systematic Troubleshooting Approach:

Variable FactorDiagnostic TestInterpretation
Enzyme qualitySDS-PAGE, Western blot, mass spectrometryAssesses purity, integrity, and homogeneity
Metal dependencyActivity testing with/without EDTA, followed by metal reconstitutionIdentifies essential metal cofactors
Temperature sensitivityActivity profiling at 5°C intervals from 0-40°CDistinguishes true cold adaptation from expression artifacts
Substrate compatibilityTesting substrate analogsReveals substrate specificity determinants
  • Statistical Analysis:

    • Apply appropriate statistical tests to determine if differences are significant

    • Consider Bayesian approaches for integrating prior knowledge with new data

    • Calculate effect sizes to quantify the magnitude of contradictions

When reporting contradictory findings, researchers should clearly document all experimental conditions and consider developing a standardized assay protocol for the field to facilitate cross-laboratory comparisons .

What are the potential biotechnological applications of recombinant S. frigidimarina CobS?

Recombinant S. frigidimarina CobS offers several promising biotechnological applications based on its unique properties:

  • Cold-Active Vitamin B12 Production:

    • Enzymatic synthesis of cobalamin at low temperatures (5-20°C)

    • Reduced energy costs for industrial production

    • Potential for producing cobalamin under conditions that minimize thermal degradation

  • Designer Cobamide Production:

    • Synthesis of novel cobamide structures with modified lower ligands

    • Production of cobalamin analogs for investigating structure-activity relationships in B12-dependent enzymes

    • Development of cobamides with enhanced stability or specialized functions

  • Biocatalysis Applications:

    • Integration into multi-enzyme cascades for stereoselective synthesis

    • Development of cold-active enzymatic processes for temperature-sensitive compounds

  • Structural Biology and Protein Engineering Platforms:

    • Model system for studying cold adaptation mechanisms

    • Template for engineering other enzymes for low-temperature activity

    • Development of stabilized variants for broader application conditions

  • Comparative Activity Matrix of Cold-Adapted vs. Mesophilic CobS:

ApplicationAdvantage of S. frigidimarina CobSPractical Benefit
Vitamin B12 productionActive at 5-20°C30-50% energy savings in cooling costs
Synthesis of heat-labile cobamidesReduced thermal degradationHigher product purity, reduced byproducts
Enzymatic bioremediationFunction in cold environmentsApplicable to cold marine/soil environments
BiosensorsActivity at ambient temperaturesReduced sensor complexity, no heating elements

The ability of CobS to incorporate different bases into the nucleotide loop of cobalamin makes it particularly valuable for producing customized cobamides with potentially novel properties. These designer cobamides could find applications in medicine, chemical synthesis, and as research tools for studying B12-dependent processes .

How can structural studies of S. frigidimarina CobS inform our understanding of cobalamin biochemistry?

Structural studies of S. frigidimarina CobS can provide significant insights into cobalamin biochemistry through several approaches:

  • Comparative Structural Analysis:

    • Alignment with mesophilic homologs reveals cold-adaptation mechanisms

    • Identification of conserved catalytic residues across diverse species

    • Understanding the structural basis for substrate specificity

  • Structure-Function Relationships:

    • Mapping of residues involved in substrate binding versus catalysis

    • Understanding conformational changes during the catalytic cycle

    • Identifying structural elements that coordinate with other enzymes in the pathway

  • Crystal Structures with Bound Substrates/Products:

    • Visualization of precise substrate positioning

    • Elucidation of transition state stabilization mechanisms

    • Understanding of product release determinants

  • Integration with Cobalamin-Dependent Enzymes:

    • Structural comparisons with cobalamin-binding domains in methionine synthase and other B12-dependent enzymes

    • Understanding how cobalamin structure influences its function as a cofactor

    • Insights into the "molecular juggling" required for B12-dependent enzyme activity

A comprehensive structural analysis would examine:

Structural FeatureAnalytical ApproachPotential Insights
Active site architectureX-ray crystallography, cryo-EMCatalytic mechanism details
Protein dynamicsHydrogen-deuterium exchange, molecular dynamicsConformational changes during catalysis
Substrate bindingIsothermal titration calorimetry, fluorescence spectroscopyThermodynamics of substrate recognition
Cold adaptationComparative B-factor analysisFlexibility differences from mesophilic enzymes
Metal coordinationX-ray absorption spectroscopyRole of metal ions in catalysis

Recent methodological advances, such as time-resolved structural studies and in crystallo catalysis observations (similar to those used for methionine synthase ), could be particularly informative for understanding the CobS reaction mechanism. These approaches could capture intermediate states during the reaction, providing unprecedented insights into how the enzyme assembles the complex cobalamin structure.

What are the current knowledge gaps in our understanding of S. frigidimarina CobS?

Despite significant advances, several critical knowledge gaps remain in our understanding of S. frigidimarina CobS:

  • Structural Determinants of Cold Adaptation:

    • High-resolution structures of S. frigidimarina CobS are still lacking

    • The specific residues responsible for cold activity are not fully characterized

    • The thermodynamic basis for maintaining catalytic efficiency at low temperatures remains poorly understood

  • Catalytic Mechanism Details:

    • Precise transition state structures during catalysis

    • Rate-limiting steps in the reaction pathway

    • Roles of specific active site residues in substrate orientation and activation

  • Physiological Regulation:

    • Transcriptional and post-translational regulation mechanisms specific to psychrophilic environments

    • Metabolic integration with other cold-adapted pathways

    • Adaptive responses to environmental stressors (oxygen, temperature fluctuations)

  • Evolutionary Context:

    • Molecular evolution of CobS in cold-adapted species

    • Horizontal gene transfer events contributing to cold adaptation

    • Comparative genomics across Shewanellaceae with varied temperature optima

  • Interaction Network:

    • Protein-protein interactions with other cobalamin biosynthesis enzymes

    • Formation and composition of potential multi-enzyme complexes

    • Metabolite channeling mechanisms between pathway components

Addressing these knowledge gaps will require multidisciplinary approaches combining structural biology, enzymology, comparative genomics, and systems biology. Particular attention should be paid to how the cold-adapted features of S. frigidimarina CobS influence its integration into the broader cellular metabolism of this psychrophilic organism .

What emerging technologies could advance research on S. frigidimarina CobS?

Several emerging technologies hold significant promise for advancing research on S. frigidimarina CobS:

  • Cryo-Electron Microscopy:

    • Visualization of enzyme complexes without crystallization

    • Capturing multiple conformational states

    • Structural analysis in near-native conditions

  • Time-Resolved X-ray Crystallography:

    • Capturing catalytic intermediates during the reaction

    • Visualizing conformational changes in real-time

    • Following the complete catalytic cycle with microsecond resolution

  • AlphaFold2 and AI-Based Structure Prediction:

    • Generating high-confidence structural models

    • Predicting effects of mutations on protein stability and function

    • Facilitating structure-based enzyme engineering

  • Single-Molecule Enzymology:

    • Detecting catalytic events at the individual molecule level

    • Revealing enzyme heterogeneity masked in bulk measurements

    • Correlating conformational dynamics with catalytic events

  • Advanced Computational Methods:

    • Quantum mechanics/molecular mechanics (QM/MM) for reaction mechanism elucidation

    • Enhanced sampling molecular dynamics for conformational exploration

    • Machine learning approaches for identifying functional patterns

TechnologyApplication to S. frigidimarina CobSExpected Impact
Native mass spectrometryCharacterizing protein-substrate complexesIdentification of transient interactions
Hydrogen-deuterium exchange MSMapping protein dynamicsUnderstanding flexibility in cold adaptation
In-cell NMRStudying the enzyme under physiological conditionsInsights into native state behavior
CRISPR-based genetic toolsPrecise genome editing in S. frigidimarinaCreation of defined mutants
Microfluidic enzyme assaysHigh-throughput activity screeningRapid characterization of variants

The integration of these technologies would provide unprecedented insights into how S. frigidimarina CobS functions at the molecular level. Particularly promising is the combination of structural methods with functional assays to correlate structure, dynamics, and activity across different temperature ranges relevant to this cold-adapted enzyme system .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.