Recombinant Shewanella frigidimarina UPF0114 protein Sfri_3655 (Sfri_3655)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Sfri_3655; UPF0114 protein Sfri_3655
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Shewanella frigidimarina (strain NCIMB 400)
Target Names
Sfri_3655
Target Protein Sequence
MEKVFERLMYASRWIMAPIYLGLSLILFALGIKFFQEIFHIIPNIFSIKEVDLVLITLSL IDITLVGGLLIMVMFSGYENFVSQLDVGENSEKLNWLGKMDAGSLKNKVAASIVAISSIH LLKVFMNAENIANDKIMWYLLIHITFVLSAFAMGYLDKITRK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Shewanella frigidimarina and why is UPF0114 protein Sfri_3655 significant for research?

Shewanella frigidimarina is a marine bacterium belonging to the gamma subgroup of proteobacteria. It was originally isolated from the North Sea near Aberdeen, UK, and demonstrates remarkable respiratory flexibility. The organism can utilize multiple electron acceptors including nitrate, nitrite, trimethylamine N-oxide, Fe(III), and Mn(IV) . This respiratory versatility makes S. frigidimarina an important model organism for studying bacterial adaptation to varying environmental conditions.

The UPF0114 protein Sfri_3655 is a protein of unknown function ("UPF" designation) encoded by the Sfri_3655 gene. The significance of this protein lies in understanding its potential role in the respiratory flexibility and environmental adaptation mechanisms of S. frigidimarina. Researching this protein contributes to our fundamental understanding of bacterial physiology, particularly in marine and potentially low-temperature environments where this organism naturally occurs .

What experimental approaches are most suitable for initial characterization of recombinant Sfri_3655?

For initial characterization of recombinant Sfri_3655, a multi-method approach is recommended:

  • Expression and Purification Protocol: Optimize expression using E. coli systems with appropriate tags (His-tag is commonly used) for efficient purification. The storage buffer typically contains Tris-buffer with 50% glycerol .

  • Structural Analysis: Employ circular dichroism (CD) spectroscopy to assess secondary structure elements, followed by X-ray crystallography or NMR for detailed three-dimensional structure.

  • Functional Assays: Based on sequence analysis suggesting membrane association, design membrane binding assays and investigate potential interactions with other respiratory components.

  • Localization Studies: Use fluorescently-tagged versions of the protein in live cells to determine subcellular localization, particularly in relation to the cell membrane.

  • Comparative Analysis: Compare with homologous proteins from related Shewanella species to identify conserved domains that might indicate functional importance .

This methodological approach provides a systematic pathway for characterization while avoiding premature functional assumptions about this protein of unknown function .

How should researchers design experiments to investigate the role of Sfri_3655 in S. frigidimarina's respiratory flexibility?

Investigating the role of Sfri_3655 in respiratory flexibility requires a carefully structured experimental design approach:

Randomized Block Design Strategy:

  • Variable Isolation: Create multiple experimental blocks based on different electron acceptors (nitrate, nitrite, Fe(III), Mn(IV)), with each block containing wild-type and Sfri_3655 knockout strains .

  • Gene Knockout Protocol: Generate Sfri_3655 deletion mutants using CRISPR-Cas9 or homologous recombination techniques. Confirm deletion using both genomic PCR and RT-qPCR to verify absence of transcription.

  • Growth Condition Matrix: Subject both wild-type and mutant strains to a matrix of growth conditions with the following structure:

Electron AcceptorOxygen LevelsTemperature (°C)Strain Types
NitrateAnaerobic4, 15, 25WT, ΔSfri_3655
NitriteAnaerobic4, 15, 25WT, ΔSfri_3655
Fe(III)Anaerobic4, 15, 25WT, ΔSfri_3655
Mn(IV)Anaerobic4, 15, 25WT, ΔSfri_3655
O₂Aerobic4, 15, 25WT, ΔSfri_3655
  • Cytochrome Expression Analysis: Measure c-type cytochrome expression levels across conditions using quantitative proteomics and correlate with Sfri_3655 expression .

  • Respiratory Rate Measurements: Quantify respiratory rates using oxygen electrodes for aerobic conditions and appropriate analytical methods for anaerobic electron acceptors.

This experimental design incorporates randomized blocking to control for variability in bacterial growth while systematically examining the protein's role across different respiratory conditions .

What approaches can be used to resolve contradictory findings regarding Sfri_3655 function in different experimental contexts?

When confronted with contradictory findings regarding Sfri_3655 function, researchers should implement a systematic troubleshooting approach:

  • Meta-analysis Protocol: Compile all experimental conditions from contradictory studies in a standardized format, identifying key variables that differ between successful and unsuccessful experiments.

  • Cross-laboratory Validation: Establish a standardized protocol to be implemented across multiple laboratories, with detailed documentation of:

    • Protein preparation methods

    • Buffer compositions and pH

    • Incubation times and temperatures

    • Analytical equipment specifications

    • Data processing algorithms

  • Variable Isolation Experiments: Design within-subjects experiments that systematically vary only one condition at a time while holding others constant .

  • Statistical Reanalysis: Apply both parametric (ANOVA, t-tests) and non-parametric tests to evaluate whether reported differences are statistically significant or potentially artifacts of the analytical approach .

  • Biological Relevance Assessment: Evaluate whether statistically significant differences translate to biologically meaningful effects by comparing magnitudes of change to known biological thresholds in respiratory systems.

How can researchers effectively design knockout/knockdown experiments to study Sfri_3655 function while avoiding compensatory mechanisms?

Designing effective knockout/knockdown experiments for Sfri_3655 requires strategies to minimize compensatory effects:

  • Inducible Expression Systems: Rather than permanent knockouts, develop tetracycline-controlled or similar inducible systems that allow temporal control of Sfri_3655 expression, enabling observation of immediate effects before compensatory mechanisms activate.

  • Graded Expression Analysis: Create a series of strains with varying levels of Sfri_3655 expression (25%, 50%, 75% of wild-type) to establish dose-dependent relationships between protein levels and phenotypic outcomes.

  • Rapid Phenotyping Protocol: Implement high-throughput phenotypic assays that can be performed immediately after knockdown induction:

Time After InductionMeasurements to Perform
0-1 hoursTranscriptome analysis (RNA-seq)
1-3 hoursProteome analysis (MS/MS)
3-6 hoursMetabolic flux analysis
6-24 hoursGrowth and respiratory measurements
24-48 hoursAdaptation assessment
  • Parallel Knockdown Strategy: Simultaneously knockdown potential compensatory genes identified through bioinformatic analysis of related UPF0114 family proteins.

  • Conditional Essentiality Testing: Evaluate knockdown effects under multiple growth conditions to determine if the protein is conditionally essential under specific respiratory modes .

This methodological approach helps distinguish primary functions from secondary adaptations, providing clearer insights into the protein's true biological role .

What are the optimal conditions for expressing recombinant Sfri_3655 protein while maintaining structural integrity?

The optimal expression conditions for recombinant Sfri_3655 require careful optimization to maintain structural integrity:

Buffer ComponentConcentrationPurpose
Tris-HCl (pH 8.0)50 mMMaintain pH stability
NaCl300-500 mMReduce non-specific interactions
Glycerol10-15%Stabilize protein structure
Reducing agent (DTT or β-ME)1-5 mMMaintain reduced state
Protease inhibitorsAs recommendedPrevent degradation
  • Solubilization Strategy: If membrane-associated, mild detergents like n-dodecyl β-D-maltoside (DDM) at 1% should be used for initial solubilization, then reduced to 0.05% for purification steps .

  • Storage Conditions: Store in Tris-based buffer with 50% glycerol at -20°C for short-term and -80°C for long-term storage. Avoid repeated freeze-thaw cycles .

These methodological considerations address the particular challenges of expressing proteins from psychrotrophic organisms, which often require special handling to maintain native conformation .

What purification strategy yields the highest purity Sfri_3655 protein suitable for structural studies?

To achieve highest purity Sfri_3655 for structural studies, implement a multi-step purification strategy:

  • Affinity Chromatography (Primary Step):

    • For His-tagged constructs: Use Ni-NTA columns with an imidazole gradient (10-250 mM)

    • Washing protocol: 10 column volumes with 20 mM imidazole to remove non-specific binding

    • Elution protocol: Step gradient with 50, 100, 150, 200, and 250 mM imidazole fractions

  • Ion Exchange Chromatography (Secondary Step):

    • Based on Sfri_3655's theoretical pI, choose appropriate ion exchange medium

    • For pI < 7: Use anion exchange (Q-Sepharose)

    • For pI > 7: Use cation exchange (SP-Sepharose)

    • Gradient elution: Linear NaCl gradient (0-500 mM)

  • Size Exclusion Chromatography (Final Step):

    • Column: Superdex 75 or 200 (depending on oligomeric state)

    • Buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol

    • Flow rate: 0.5 ml/min to maximize resolution

  • Purity Assessment Protocol:

    • SDS-PAGE (>95% single band)

    • Western blot (specific antibody recognition)

    • Mass spectrometry (identity confirmation)

    • Dynamic light scattering (monodispersity check)

  • Concentration Strategy: Use centrifugal concentrators with appropriate molecular weight cutoff (10 kDa), concentrating in steps with gentle mixing between centrifugation cycles to prevent aggregation .

This methodical approach ensures isolation of homogeneous protein suitable for crystallography or other structural studies while maintaining the integrity of the potentially membrane-associated protein .

How can researchers optimize the yield of functional Sfri_3655 from psychrophilic expression systems?

Optimizing yield from psychrophilic expression systems requires specialized approaches:

  • Cold-Adapted Expression System Selection: Consider using the Arctic Express system (containing chaperonins Cpn10 and Cpn60 from the psychrophilic bacterium Oleispira antarctica) or similar systems designed for cold-temperature expression.

  • Temperature-Staged Expression Protocol:

StageTemperatureDurationPurpose
Growth30°CUntil OD600 = 0.6-0.8Achieve sufficient cell density
Temperature adjustmentGradual cooling30 minAcclimate cells to cold
Induction10-15°C24-48 hoursExpress protein at psychrophilic temperatures
  • Media Formulation: Supplement standard media with:

    • Additional amino acids (0.2% each of Ala, Gly, Pro)

    • Osmolytes (5% sorbitol)

    • Cold-shock proteins inducers (1% ethanol)

  • Specialized Vector Elements: Incorporate cold-shock promoters (such as cspA) and origin of replication optimized for low-temperature function.

  • Harvest and Lysis Protocol: Perform all steps at 4°C with pre-chilled buffers containing additional stabilizers:

    • 5-10% glycerol

    • 1-2% glucose

    • 1 mM EDTA

    • Complete protease inhibitor cocktail

  • Yield Monitoring System: Implement real-time monitoring of expression through:

    • Reporter gene fusion constructs

    • Regular sampling for protein quantification

    • Activity assays specific to predicted function

This methodological approach addresses the specific challenges of expressing proteins from psychrophilic organisms, which often require specialized handling to maintain native conformation and activity at lower temperatures .

What experimental designs are most appropriate for determining if Sfri_3655 participates in electron transport systems?

To investigate Sfri_3655's potential role in electron transport systems, implement a comprehensive experimental design:

  • Membrane Fractionation Protocol: Isolate membrane fractions from wild-type and Sfri_3655 knockout strains grown under different electron acceptor conditions.

  • Electron Transport Chain Activity Assays:

    • NADH oxidase activity measurement

    • Succinate dehydrogenase activity

    • Cytochrome oxidase activity

    • Ferric reductase activity

  • Comparative Respiratory Activity Analysis:

Electron AcceptorWild-type ActivityΔSfri_3655 ActivityActivity RatioStatistical Significance
O₂[value][value][ratio][p-value]
NO₃⁻[value][value][ratio][p-value]
Fe(III)[value][value][ratio][p-value]
Mn(IV)[value][value][ratio][p-value]
  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation with known components of the electron transport chain

    • Bacterial two-hybrid screening

    • Cross-linking followed by mass spectrometry (XL-MS)

    • FRET analysis with fluorescently labeled electron transport components

  • Electrochemical Analysis:

    • Cyclic voltammetry of purified protein

    • Protein film voltammetry on electrode surfaces

    • Potentiometric titrations to identify redox-active centers

This structured experimental approach combines biochemical, genetic, and biophysical methods to comprehensively evaluate potential roles in electron transport .

How can researchers distinguish between direct and indirect effects when analyzing Sfri_3655 knockout phenotypes?

Distinguishing between direct and indirect effects in Sfri_3655 knockout phenotypes requires a multi-tiered experimental approach:

  • Time-Resolved Phenotypic Analysis:

    • Implement a conditional expression system (tetracycline-controlled)

    • Monitor physiological changes at multiple time points after protein depletion:

Time After DepletionMeasurementsExpected for Direct EffectsExpected for Indirect Effects
0-1 hoursTranscriptome, proteomeMinimal changes except for direct targetsMinimal changes
1-3 hoursMetabolome, respiratory ratesChanges in directly affected pathwaysMinimal changes
3-6 hoursGrowth, substrate utilizationManifestation of primary phenotypesBeginning of secondary effects
6-24 hoursComprehensive physiologyStabilization of primary effectsSignificant secondary adaptations
  • Complementation Analysis Protocol:

    • Reintroduce wild-type Sfri_3655 under inducible control

    • Introduce mutated versions with alterations in key domains

    • Quantify degree of phenotype rescue for each variant

  • In Vitro Reconstitution Experiments:

    • Purify components of potentially affected pathways

    • Reconstruct minimal systems with and without Sfri_3655

    • Measure direct biochemical activities

  • Statistical Causal Analysis:

    • Apply Granger causality testing to time-series data

    • Implement structural equation modeling to test direct vs. indirect relationships

    • Calculate Bayesian networks to identify the most probable causal relationships .

This methodological framework helps separate immediate consequences of protein absence from downstream adaptations, providing clearer insights into the protein's primary function .

What computational approaches can predict potential functional partners of Sfri_3655 to guide experimental design?

Computational prediction of Sfri_3655 functional partners should employ multiple complementary approaches:

  • Genome Context Analysis:

    • Examine gene neighborhood conservation across Shewanella species

    • Identify consistent co-occurrence patterns

    • Analyze operon structures and potential co-regulation

  • Network-Based Prediction Protocol:

    • Construct protein-protein interaction networks from:

      • Experimental data (if available)

      • Homology-based inference

      • Co-expression data

    • Apply network analysis algorithms (PageRank, PRINCE, Random Walk with Restart)

  • Structure-Based Partner Prediction:

    • Generate 3D structural models using AlphaFold2 or RoseTTAFold

    • Perform protein-protein docking with predicted partners

    • Calculate binding energy and interface statistics

  • Integrative Scoring System:

Prediction MethodWeightTop Predicted PartnersConfidence Score
Genomic context0.3[Protein 1, Protein 2...][Scores]
Co-expression0.2[Protein 1, Protein 2...][Scores]
Domain co-occurrence0.15[Protein 1, Protein 2...][Scores]
Structural compatibility0.25[Protein 1, Protein 2...][Scores]
Literature mining0.1[Protein 1, Protein 2...][Scores]
Integrated score1.0[Final ranked list][Combined scores]
  • Experimental Validation Design:

    • Prioritize top 5-10 predicted partners for experimental validation

    • Design targeted co-immunoprecipitation or bacterial two-hybrid experiments

    • Plan comparative phenotypic analysis of single vs. double knockouts .

This computational pipeline guides experimental design by generating testable hypotheses about functional relationships, particularly valuable for proteins of unknown function like Sfri_3655 .

How might Sfri_3655 research contribute to understanding bacterial adaptation to extreme environments?

Research on Sfri_3655 offers significant insights into bacterial adaptation to extreme environments:

  • Cold Adaptation Mechanisms: As S. frigidimarina is psychrotrophic and has been isolated from Antarctic sea-ice, studying Sfri_3655 may reveal specialized protein adaptations for function at low temperatures. These could include:

    • Modified hydrophobic cores

    • Increased surface flexibility

    • Altered electrostatic interactions

    • Special membrane integration mechanisms

  • Respiratory Versatility Analysis: The organism's ability to use diverse electron acceptors (including Fe(III) and Mn(IV)) represents a key adaptation strategy. If Sfri_3655 is involved in this process, it may:

    • Contribute to energy generation under oxygen-limited conditions

    • Enable colonization of redox-stratified environments

    • Facilitate adaptation to fluctuating redox conditions

  • Comparative Genomics Application: By analyzing Sfri_3655 homologs across environmental gradients:

    • Chart evolutionary adaptations to different extreme environments

    • Identify convergent adaptations in unrelated organisms

    • Map the distribution of this protein family across ecological niches

  • Stress Response Integration: Determine whether Sfri_3655 functions in broader stress response networks by:

    • Measuring expression changes under multiple stressors

    • Evaluating knockout phenotypes under combined stresses

    • Assessing protein-protein interactions with known stress response factors .

These research directions contribute foundational knowledge about bacterial adaptation mechanisms that may have applications in biotechnology and our understanding of microbial ecology in extreme environments .

What are the most promising approaches for resolving the structure-function relationship of UPF0114 family proteins?

Resolving structure-function relationships for the UPF0114 family requires an integrated approach:

  • Comprehensive Structural Biology Protocol:

    • X-ray crystallography of multiple family members

    • Cryo-EM for membrane-associated complexes

    • NMR for dynamic regions and ligand interactions

    • Small-angle X-ray scattering (SAXS) for solution behavior

  • Structure-Guided Mutagenesis Strategy:

    • Generate a library of point mutations based on structural data

    • Focus on:

      • Conserved residues across family members

      • Predicted functional sites

      • Membrane-interacting regions

      • Potential ligand-binding pockets

  • Molecular Dynamics Simulation Protocol:

    • Simulate protein behavior in membrane environments

    • Model potential conformational changes

    • Calculate energy landscapes for different functional states

    • Predict effects of mutations on stability and function

  • Evolutionary Analysis Framework:

    • Perform ancestral sequence reconstruction

    • Map evolutionary constraints on the structural model:

Structural RegionConservation ScorePredicted Functional ImportanceExperimental Validation
N-terminal region[score][prediction][validation approach]
Transmembrane domain 1[score][prediction][validation approach]
Central loop[score][prediction][validation approach]
Transmembrane domain 2[score][prediction][validation approach]
C-terminal region[score][prediction][validation approach]
  • Integrated Functional Testing:

    • Correlate structural features with phenotypic effects of mutations

    • Identify structure-function relationships through statistical pattern analysis .

This methodological framework addresses the particular challenges of membrane-associated proteins and families with unknown functions, providing a path to functional annotation .

What experimental design would best identify potential biotechnological applications of Sfri_3655?

A comprehensive experimental design to identify biotechnological applications of Sfri_3655 would include:

  • Bioremediation Potential Assessment:

    • Evaluate effects of Sfri_3655 overexpression on:

      • Heavy metal reduction rates

      • Degradation of specific pollutants

      • Survival under contaminated conditions

  • Bioenergy Application Screening:

    • Test engineered systems with modified Sfri_3655 expression for:

      • Enhanced electron transfer to electrodes in microbial fuel cells

      • Improved hydrogen production

      • Optimized extracellular electron transfer

  • Biosensor Development Protocol:

    • Engineer reporter systems fused to Sfri_3655 promoter

    • Screen responsiveness to:

      • Environmental pollutants

      • Redox state changes

      • Temperature fluctuations

  • Protein Engineering Matrix:

Engineering ApproachTarget PropertyAssessment MethodPotential Application
Stability enhancementThermostabilityThermal shift assaysIndustrial enzymes
Substrate specificityElectron acceptor rangeElectrode-based assaysSpecialized bioremediation
Expression optimizationYield in heterologous hostsQuantitative proteomicsScalable bioprocesses
Functional fusionReporter attachmentFluorescence/luminescenceBiosensors
  • Scale-up Feasibility Testing:

    • Pilot-scale experiments of promising applications

    • Process optimization for:

      • Maximum activity

      • Stability under operational conditions

      • Cost-effectiveness analysis .

This systematic approach identifies multiple potential biotechnological applications while establishing protocols to assess their practicality and scalability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.