Recombinant Shewanella halifaxensis Probable ubiquinone biosynthesis protein UbiB (ubiB)

What is UbiB protein and what is its role in ubiquinone biosynthesis?

UbiB is a protein involved in the ubiquinone (CoQ) biosynthesis pathway, specifically required for the first monooxygenase step. Studies in Escherichia coli, where UbiB has been more extensively characterized, demonstrate that disruption of ubiB leads to accumulation of octaprenylphenol, the substrate for the first hydroxylation reaction in the pathway . The protein contains motifs found in eukaryotic-type protein kinases, suggesting it may function through phosphorylation activities . Current research indicates UbiB may regulate ubiquinone biosynthesis by activating proteins necessary for the monooxygenase step through phosphorylation, though this mechanism has not been definitively proven.

When analyzing UbiB function, it's important to note that its role appears condition-dependent, with different effects observed during logarithmic versus stationary growth phases, potentially reflecting regulatory functions beyond direct catalytic activity .

How is UbiB conserved across different bacterial species?

UbiB belongs to a larger family of proteins containing motifs characteristic of eukaryotic-type protein kinases. Homologs have been identified across diverse bacterial species:

• In Escherichia coli as ubiB

• Across multiple Shewanella species (including S. halifaxensis and S. pealeana)

• In Providencia stuartii (designated as aarF)

• In Saccharomyces cerevisiae (a homolog called ABC1)

Disruption mutants of ubiB in E. coli and ubiB (aarF) in P. stuartii both accumulate octaprenylphenol, indicating functional conservation in the first monooxygenase step of CoQ biosynthesis . The conservation pattern suggests evolutionary importance, though functional conservation may vary across distant species.

What expression systems are available for producing recombinant Shewanella halifaxensis UbiB?

Multiple expression systems have been developed for recombinant production of S. halifaxensis UbiB, each offering distinct advantages for different research applications:

What structural features characterize UbiB from Shewanella species?

The full-length UbiB protein from the related species Shewanella pealeana consists of 549 amino acids . Available sequence data reveals several important structural features:

• Motifs characteristic of eukaryotic-type protein kinases, suggesting a potential regulatory function

• Both hydrophilic and hydrophobic regions, consistent with potential membrane association

• The C-terminal region includes predicted transmembrane segments that may anchor the protein to the membrane

The amino acid sequence of S. pealeana UbiB includes significant hydrophobic stretches in the C-terminal region (residues SAILVICGTILLNQDATLWPSYGSIGIGITLWVLGW), suggesting membrane association . This is consistent with UbiB's role in ubiquinone biosynthesis, which occurs at the membrane interface where both hydrophilic (kinase-like) domains and membrane-interacting regions would be functionally important.

For crystallography or structural studies, researchers should consider using truncated constructs focusing on the kinase-like domains to improve solubility while maintaining functional relevance.

How does UbiB function differ between aerobic and anaerobic conditions?

UbiB exhibits condition-dependent functionality that varies significantly between aerobic and anaerobic environments:

• Under aerobic conditions during logarithmic growth, UbiB is essential for ubiquinone biosynthesis in E. coli, with mutants accumulating octaprenylphenol

• Under anaerobic conditions, UbiB function can be bypassed through alternative hydroxylase activities, allowing ubiquinone biosynthesis to proceed despite UbiB deficiency

• Similarly, in stationary phase cultures, the UbiB requirement appears to be circumvented through mechanisms resembling those activated under anaerobic conditions

This conditional requirement pattern suggests UbiB may function as a regulatory protein that coordinates ubiquinone biosynthesis with oxygen availability and metabolic state. Most Shewanella species possess both ubiquinones (typically associated with aerobic respiration) and menaquinones (associated with anaerobic respiration) . S. oneidensis mutants deficient in menaquinone but retaining normal ubiquinone levels lose the ability to utilize nitrate, iron(III), and fumarate as electron acceptors, indicating distinct respiratory roles for different quinone types .

What experimental approaches can be used to study the potential kinase activity of UbiB?

Investigating UbiB's putative kinase activity requires multi-faceted approaches:

• In vitro phosphorylation assays:

  • Purify recombinant UbiB using affinity chromatography with N-terminal His-tag

  • Identify potential substrate proteins involved in ubiquinone biosynthesis

  • Develop assays using [γ-³²P]ATP to detect phosphate transfer

  • Validate with phospho-specific antibodies if phosphorylation sites are identified

• Site-directed mutagenesis of kinase domains:

  • Target conserved residues in kinase-like motifs

  • Compare ability of mutants to complement UbiB-deficient strains

  • Correlate kinase activity with ubiquinone production levels

• Phosphoproteomic analysis:

  • Compare phosphoproteomes of wild-type versus UbiB-deficient strains

  • Focus on proteins involved in ubiquinone biosynthesis pathway

  • Quantify differential phosphorylation under varying oxygen conditions

• Protein-protein interaction studies:

  • Identify binding partners using co-immunoprecipitation or bacterial two-hybrid screening

  • Test direct interactions with components of the ubiquinone biosynthetic machinery

  • Determine if interactions are influenced by phosphorylation state

Recent studies with ABC1, the yeast homolog of UbiB, have strengthened the kinase function hypothesis, as this protein is now known to be required for CoQ biosynthesis, potentially through similar mechanisms .

How can researchers quantify ubiquinone production in UbiB mutants versus wild-type strains?

Accurate quantification of ubiquinone levels is essential for understanding UbiB function. The following methodological approaches are recommended:

• HPLC-based quantification protocol:

  • Extract cellular lipids using hexane/ethanol extraction

  • Separate quinones using reverse-phase HPLC

  • Detect ubiquinone using UV absorbance at 275 nm

  • Quantify against standards with appropriate standard curves

• Sample preparation considerations:

  • Standardize cell harvesting at consistent growth phases

  • Normalize to dry cell weight for accurate comparisons

  • Process samples rapidly to prevent oxidation of quinones

• Expected values and interpretation:

  • Wild-type E. coli typically produces 180-190 ng CoQ₈/mg dry cell weight in stationary phase

  • UbiB mutants produce significantly less (approximately 45-50 ng CoQ₈/mg)

  • Complemented strains should show restoration toward wild-type levels

• Advanced analytical options:

  • LC-MS/MS for simultaneous identification and quantification of multiple quinone species and intermediates

  • Include internal standards to control for extraction efficiency

  • Consider labeled precursor incorporation studies to assess de novo synthesis rates

This quantitative data provides clear benchmarks for evaluating UbiB function and the success of experimental manipulations .

How can researchers investigate the bypass mechanism of UbiB deficiency in stationary phase cultures?

The ability of UbiB-deficient strains to synthesize ubiquinone during stationary phase represents a fascinating regulatory mechanism that can be investigated through:

• Comparative transcriptomics:

  • RNA-seq analysis comparing gene expression between:

    • Log phase versus stationary phase cultures

    • Wild-type versus UbiB mutant strains

    • Aerobic versus anaerobic conditions

  • Focus on genes encoding alternative hydroxylases or regulatory factors

• Metabolomic profiling:

  • Track accumulation of ubiquinone intermediates across growth phases

  • Identify alternative metabolic routes activated in stationary phase

  • Compare metabolite profiles between UbiB mutants and other ubiquinone pathway mutants (e.g., UbiG mutants that do not show bypass)

• Genetic screening approaches:

  • Construct double mutants combining UbiB deficiency with mutations in other genes

  • Screen for mutants that eliminate the stationary phase bypass

  • Identify genes essential for the alternative pathway

• Oxygen-dependent regulation studies:

  • Monitor ubiquinone production during transitions between aerobic and anaerobic growth

  • Compare with regulation patterns in stationary phase

  • Test if artificial anaerobiosis triggers the bypass mechanism in log phase

Previous studies indicate the stationary phase bypass resembles the anaerobic bypass mechanism, suggesting shared regulatory controls and alternative hydroxylases functioning under both conditions .

What considerations are important when designing site-directed mutagenesis studies of UbiB?

Strategic mutagenesis approaches are critical for dissecting UbiB function:

• Priority target sites:

  • Conserved residues within predicted kinase domains

  • Putative active site residues based on homology modeling

  • Sequence regions conserved across diverse bacterial species

  • Potential membrane-interacting domains

• Mutation strategies:

  • Alanine scanning of conserved motifs

  • Conservative substitutions to test specific chemical properties

  • Phosphomimetic mutations (S/T → D/E) for potential regulatory sites

  • Domain truncations to separate functional regions

• Functional validation approaches:

  • Complementation assays in UbiB-deficient backgrounds

  • Quantitative measurement of ubiquinone production

  • Growth phenotypes under various respiratory conditions

  • Protein stability and localization analysis

• Controls and comparison systems:

  • Include wild-type UbiB as positive control

  • Compare with known inactive variants

  • Test mutations in both E. coli and Shewanella systems

  • Include mutations in homologous positions from better-characterized systems

When designing mutations, consider that the bypass mechanism observed in stationary phase and anaerobic conditions suggests that UbiB likely plays a regulatory role rather than serving as the catalytic monooxygenase itself, making regulatory domain mutations particularly informative .

What control strains should be included when studying UbiB function in Shewanella species?

A comprehensive experimental design requires carefully selected control strains:

• Essential control strains:

  • Wild-type Shewanella halifaxensis (positive control for normal ubiquinone biosynthesis)

  • Clean UbiB deletion mutant (to observe specific effects of UbiB absence)

  • Complemented strain (UbiB deletion with plasmid-expressed wild-type UbiB)

  • E. coli UbiB mutant complemented with S. halifaxensis UbiB (cross-species functionality test)

• Additional informative control strains:

  • UbiG deletion mutant (methyltransferase-deficient, shows no stationary phase bypass)

  • UbiH or UbiF mutants (affected in other monooxygenase steps, may show similar bypass)

  • Menaquinone-deficient mutants (to investigate quinone system interactions)

  • Double mutants combining UbiB deficiency with mutations in related pathways

• Strain validation requirements:

  • Confirm genotypes through PCR verification

  • Validate phenotypes via growth tests on respiratory substrates

  • Verify quinone profiles through HPLC analysis

  • Ensure stable maintenance of complementation plasmids

These controls allow researchers to distinguish UbiB-specific effects from general respiratory defects and provide critical comparisons for interpreting experimental results.

How should researchers design experiments to investigate UbiB regulation under varying oxygen conditions?

Oxygen-dependent regulation of UbiB can be investigated through carefully controlled experimental designs:

• Precise oxygen control systems:

  • Use bioreactors with dissolved oxygen monitoring capabilities

  • Establish defined microaerobic conditions (1-5% oxygen)

  • Compare fully aerobic, microaerobic, and strictly anaerobic cultures

  • Include rapid transition experiments between oxygen states

• Transcriptional regulation analysis:

  • Quantify UbiB mRNA levels using qRT-PCR under varying oxygen conditions

  • Map the UbiB promoter region and identify potential oxygen-responsive elements

  • Construct reporter fusions (UbiB promoter driving luciferase or GFP)

  • Monitor expression dynamics during oxygen transitions

• Protein-level regulation:

  • Generate antibodies against UbiB or use epitope-tagged versions

  • Assess protein abundance through western blotting

  • Determine protein half-life under different oxygen conditions

  • Investigate potential post-translational modifications

• Functional correlations:

  • Measure ubiquinone and menaquinone levels in parallel with UbiB expression

  • Compare with other oxygen-regulated respiratory proteins

  • Correlate UbiB activity with growth rates on different electron acceptors

  • Test genetic manipulations that decouple oxygen sensing from UbiB expression

Studies in Shewanella should consider that these organisms possess both ubiquinones (typically associated with aerobic metabolism) and menaquinones (associated with anaerobic metabolism), suggesting sophisticated regulatory mechanisms for electron transport chain components .

What methods are recommended for purification of recombinant UbiB while maintaining its activity?

Purifying UbiB while preserving functional activity requires careful optimization:

• Expression system selection:

  • E. coli expression systems yield good protein quantities but may require refolding

  • Consider His-tagged constructs for affinity purification as demonstrated with S. pealeana UbiB

  • For challenging cases, explore baculovirus or mammalian expression systems

• Purification strategy:

  • Immobilized metal affinity chromatography (IMAC) using His-tag

  • Additional purification via ion exchange or size exclusion chromatography

  • Consider detergent selection if membrane association is present

  • Aim for >90% purity as verified by SDS-PAGE

• Buffer optimization critical factors:

  • Include 6% trehalose or 50% glycerol in final storage buffer

  • Maintain pH 8.0 for optimal stability

  • Include reducing agents to prevent oxidation of cysteine residues

  • Test addition of potential cofactors (ATP, divalent cations)

• Storage and handling recommendations:

  • Aliquot purified protein to minimize freeze-thaw cycles

  • Store at -20°C/-80°C for long-term storage

  • Reconstitute lyophilized protein to 0.1-1.0 mg/mL concentration

  • Validate activity immediately after purification and periodically during storage

Following these guidelines will help maintain UbiB in its native conformation and preserve putative kinase activity needed for functional studies.

How can researchers differentiate between direct and indirect effects of UbiB on the CoQ biosynthesis pathway?

Distinguishing direct from indirect UbiB effects requires sophisticated experimental approaches:

• In vitro reconstitution:

  • Attempt to reconstitute the octaprenylphenol hydroxylation reaction with purified components

  • Test direct effects of UbiB on reaction rates and product formation

  • Include ATP and potential phosphorylation substrates in the reaction mixture

  • Compare activity with and without UbiB or with mutated versions

• Genetic bypass experiments:

  • Overexpress other components of the ubiquinone biosynthesis pathway in UbiB mutants

  • Test if high expression of potential UbiB targets can bypass UbiB deficiency

  • Create constitutively active versions of potential regulatory targets

• Kinetic analyses:

  • Use inducible/repressible UbiB expression systems to determine time-course of effects

  • Monitor immediate versus delayed consequences of UbiB activation/inactivation

  • Track accumulation rates of pathway intermediates to identify rate-limiting steps

• Protein interaction mapping:

  • Identify all proteins that physically interact with UbiB

  • Determine which interactions change under different oxygen conditions

  • Create interaction-deficient UbiB variants to test functional consequences

The fact that UbiB mutations affect ubiquinone biosynthesis specifically in log phase but not stationary phase suggests a regulatory rather than direct catalytic role, providing an important experimental framework for distinguishing these functions .

How can researchers interpret contradictory results between UbiB activity in log phase versus stationary phase?

Interpreting phase-dependent UbiB function requires careful data analysis:

• Physiological context considerations:

  • Log phase cells are actively dividing with different metabolic demands than stationary phase cells

  • Stationary phase triggers multiple stress responses that may activate alternative pathways

  • Energy requirements and redox balance differ significantly between growth phases

• Appropriate data normalization approaches:

  • Normalize ubiquinone measurements to dry cell weight rather than optical density

  • Consider cell size and composition differences between growth phases

  • Report both absolute and relative quinone levels for complete interpretation

• Comparative analyses:

  • Contrast UbiB-deficient strains with UbiG mutants (which show no bypass in stationary phase)

  • Compare with other monooxygenase mutants (UbiH, UbiF) that may exhibit similar bypass

  • Analyze parallel requirements in aerobic versus anaerobic cultures

• Mechanistic interpretations:

  • The stationary phase bypass likely represents activation of alternative hydroxylases

  • This resembles the bypass mechanism observed under anaerobic conditions

  • The pattern suggests UbiB functions in a regulatory capacity rather than as the primary catalytic enzyme

  • Consider regulatory connections to other stationary phase responses

The experimental observation that UbiB-deficient strains produce approximately 48.7 ± 2.8 ng CoQ₈/mg dry weight in stationary phase (compared to 184.0 ± 5.0 ng in wild-type) provides quantitative evidence of this partial bypass phenomenon .

What are the best approaches to compare UbiB function across different Shewanella species?

Cross-species functional comparison requires systematic approaches:

• Comparative genomic analysis:

  • Align UbiB sequences from multiple Shewanella species

  • Identify conserved domains and species-specific variations

  • Correlate sequence differences with ecological niches

  • Construct phylogenetic trees to establish evolutionary relationships

• Heterologous expression studies:

  • Express UbiB from different Shewanella species in a common host (E. coli UbiB mutant)

  • Quantify degree of functional complementation through ubiquinone measurements

  • Analyze growth rates on different respiratory substrates

  • Assess membrane localization patterns

• Biochemical characterization:

  • Compare enzymatic properties of purified UbiB proteins from different species

  • Assess potential kinase activity against common substrates

  • Measure temperature and pH optima for activity

  • Evaluate oxygen sensitivity profiles

• Ecological context correlations:

  • Relate UbiB sequence/function to species' native environments

  • Consider adaptations to marine (S. halifaxensis) versus other environments

  • Test species-specific responses to relevant stressors

  • Analyze quinone composition patterns across species

Shewanella species are known to have both ubiquinones and menaquinones, with the latter being particularly important for anaerobic respiration using various electron acceptors like nitrate and iron(III) . Species-specific variations in UbiB may reflect adaptations to different electron acceptor availability in their natural habitats.

How can researchers determine if UbiB has additional functions beyond ubiquinone biosynthesis?

Investigating potential moonlighting functions of UbiB requires multifaceted approaches:

• Comprehensive phenotypic analysis:

  • Compare wild-type and UbiB mutants across hundreds of growth conditions

  • Look for phenotypes that cannot be explained by ubiquinone deficiency alone

  • Test sensitivity to various stressors (oxidative, osmotic, pH, temperature)

  • Measure biofilm formation, motility, and other complex phenotypes

• Multi-omics integration:

  • Perform comparative transcriptomics, proteomics, and metabolomics

  • Use network analysis to identify affected pathways beyond ubiquinone biosynthesis

  • Focus on stationary phase and stress responses where alternative functions may be revealed

  • Identify gene expression changes that differ from other ubiquinone biosynthesis mutants

• Suppressor screening:

  • Identify mutations that suppress specific UbiB-deficient phenotypes without restoring ubiquinone

  • Categorize suppressors by functional class to reveal potential additional pathways

  • Test if suppressors affect the stationary phase bypass mechanism

• Protein localization and dynamics:

  • Track UbiB localization throughout growth phases and under different conditions

  • Look for unexpected subcellular locations suggesting additional functions

  • Monitor potential dynamic changes in localization or interaction partners

The observation that UbiB contains kinase-like domains suggests potential regulatory functions beyond direct involvement in ubiquinone biosynthesis . Additionally, the condition-specific requirement for UbiB (in log phase but not stationary phase) points to regulatory roles that may extend to other cellular processes.