Recombinant Shewanella halifaxensis Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Shewanella halifaxensis Protease HtpX (htpX) is a zinc-dependent metalloprotease belonging to the M48 family, expressed as a recombinant protein for research and therapeutic applications. Native HtpX is a transmembrane protein involved in proteolytic quality control, particularly in degrading misfolded or damaged membrane proteins . Its recombinant form is engineered for structural and functional studies, leveraging its conserved catalytic domains and substrate specificity .

Primary Sequence and Domains

The full-length HtpX protein (287 amino acids) includes:

  • N-terminal signal peptide: Directs membrane localization.

  • Active site: Contains zinc-binding motifs (e.g., HEXXH) critical for proteolytic activity .

  • Transmembrane regions: Anchor the enzyme to the cytoplasmic membrane .

FeatureDetails
Uniprot IDB0TJN4 (Shewanella halifaxensis)
Molecular Weight~31.5 kDa (calculated)
Zinc DependencyRequires Zn²⁺ for self-cleavage and substrate degradation
Purity>85–90% (SDS-PAGE validated)

Recombinant Expression

Produced in E. coli via N-terminal His-tagged systems, enabling affinity chromatography purification . Storage conditions include:

  • Buffer: Tris-based, 50% glycerol, pH 8.0

  • Temperature: -20°C or -80°C

Recombinant Production and Applications

  1. Protease Activity Assays:

    • In vivo models: Detects HtpX-mediated degradation of engineered substrates (e.g., SecY in E. coli) .

    • Mutant analysis: Screens for catalytic region mutations (e.g., zinc-binding site disruptions) .

  2. Antibiotic Resistance Studies:

    • Aminoglycoside resistance: HtpX degrades antibiotic-damaged proteins, contributing to intrinsic resistance in Stenotrophomonas maltophilia .

Role in Protein Quality Control

HtpX collaborates with FtsH (an ATP-dependent protease) to degrade misfolded membrane proteins . In E. coli, it cleaves SecY, a component of the protein translocation machinery, under stress conditions .

Mechanism of Aminoglycoside Resistance

In S. maltophilia, HtpX and ClpA proteases degrade proteins damaged by aminoglycosides (e.g., kanamycin), reducing antibiotic toxicity. Dual inactivation of clpA and htpX significantly lowers resistance, making them therapeutic targets .

ProteaseFunctionImpact on Resistance
HtpXMembrane protein degradationCompromises intrinsic resistance
ClpACytoplasmic protein degradationWeakens efflux pump-mediated resistance

Homologs in Other Bacteria

OrganismHtpX FunctionKey Differences
E. coli Membrane protein quality controlSoluble/secreted vs. membrane-bound
S. maltophilia Antibiotic resistanceSynergizes with ClpA proteases
Shewanella piezotolerans Hypothetical roles in stress responseDistinct sequence motifs

Challenges and Considerations

  • Renaturation: Recombinant HtpX requires zinc supplementation post-purification to restore activity .

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquot storage at 4°C is recommended for short-term use .

  • Substrate Specificity: Limited data on native substrates in Shewanella, unlike E. coli .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend consulting your local distributor for specific delivery timelines.
Please note: All protein shipments are dispatched with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type will be finalized during production. If you have a specific tag type requirement, please inform us and we will prioritize developing your specified tag.
Synonyms
htpX; Shal_2473; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Shewanella halifaxensis (strain HAW-EB4)
Target Names
htpX
Target Protein Sequence
MKRIFLLIATNMAILLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK TMGCEVITTPRDNTERWLVETVARQAEQAGIKMPEVAIYQSPELNAFATGPSKNNALVAV SSGLLYGMSQDEIEAVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVAGIINNFVAS NDEEGEGLGMFAYMAVVFVLDMLFGILASIIVAYFSRIREYRADEGAARLAGKEKMIAAL DRLRQGPETGAMPASMSALGINGKKSMAELLMSHPPLEKRIAALRAS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining HtpX stability?

For optimal stability of Recombinant Shewanella halifaxensis Protease HtpX, store the protein at -20°C in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein . For extended storage periods, it is recommended to conserve the protein at -80°C. To prevent repeated freeze-thaw cycles which can degrade protein integrity, prepare working aliquots and store them at 4°C for up to one week .

The protein should be maintained in its storage buffer until experimental use, as buffer exchanges may impact stability. When designing experiments, consider that wild-type HtpX undergoes rapid self-cleavage during cell disruption and/or membrane solubilization with detergent, which has significant implications for experimental design .

How does HtpX function in protein quality control mechanisms?

HtpX plays a central role in protein quality control by preventing the accumulation of misfolded proteins in the membrane . As an integral membrane metallopeptidase, it cleaves misfolded or damaged membrane proteins, specifically targeting cytoplasmic regions of these proteins. This has been demonstrated through in vivo studies showing that HtpX cleaves only the cytoplasmic regions of membrane protein SecY .

The protease activity depends on the characteristic zinc-binding motif (HEXXH), with H139 and H143 coordinating the catalytic zinc ion, and E140 functioning as a general base and acid during catalysis by activating the catalytic water molecule that attacks the substrate . This proteolytic activity is part of a cellular quality control system that prevents proteotoxic stress caused by the accumulation of misfolded proteins in the membrane environment.

What experimental approaches are recommended for the heterologous expression and purification of functional HtpX?

Based on research findings, the following optimized protocol has proven successful for heterologous expression and purification of HtpX:

Expression System:

  • Host: E. coli BL21(DE3) cells

  • Vector: pET-derived vector with C-terminal His8-tag

  • Expression conditions: Induction protocols should be optimized based on your specific construct

Purification Protocol:

  • Membrane extraction using octyl-β-D-glucoside detergent

  • Three-step purification:

    • Cobalt-affinity chromatography

    • Anion-exchange chromatography

    • Size-exclusion chromatography

Critical Considerations:

  • Wild-type HtpX undergoes rapid self-cleavage during purification

  • To obtain stable protein, generate a catalytically ablated variant (E140A) that maintains structural integrity while preventing self-cleavage

  • The E140A mutation disrupts the catalytic activity by preventing proper function of the glutamic acid that serves as a general base/acid during catalysis

This approach has successfully yielded milligram quantities of pure, well-folded protein suitable for structural and biochemical studies.

What are the key differences between HtpX and other membrane-bound metallopeptidases?

HtpX differs from other integral membrane metallopeptidases (IMMPs) in several important aspects:

FeatureHtpXOther IMMPs (e.g., Oma1)Significance
Cleavage DirectionCleaves only cytoplasmic regions of substrate proteinsMay cleave on both sides of the membrane (e.g., Oma1)Impacts substrate selection and functional roles
Zinc CoordinationH139, H143, and likely E222 from the "glutamate helix"Similar HEXXH motif but with structural variationsDetermines catalytic mechanism and specificity
Self-regulationUndergoes self-cleavage (wild-type)Variable among different IMMPsAffects experimental handling and physiological regulation
Transmembrane TopologyFour transmembrane segments with cytosolic catalytic domainVariable transmembrane architecturesInfluences substrate accessibility and membrane integration

Unlike some related proteases, HtpX functions specifically in the context of protein quality control, preventing the accumulation of misfolded proteins in the membrane . This specialized function contrasts with other IMMPs that may serve additional roles in membrane protein processing or signaling.

How can researchers address the self-cleavage behavior of wild-type HtpX in experimental settings?

Wild-type HtpX undergoes rapid self-cleavage during cell disruption and/or membrane solubilization with detergent, presenting a significant challenge for researchers . Three methodological approaches can address this issue:

Approach 1: Use of Catalytically Ablated Mutants

  • Generate E140A mutant: This mutation disrupts the general base/acid function in catalysis while maintaining structural integrity

  • Alternative: H139F mutation disrupts zinc coordination, resulting in an inactive enzyme that does not undergo self-cleavage

Approach 2: Purification Under Modified Conditions

  • Purify under denaturing conditions followed by refolding in the presence of metal chelators

  • When supplemented with zinc ion, the enzyme can regain catalytic activity against substrates like casein and SecY

Approach 3: Fusion Protein Strategies

  • Express HtpX with fusion partners such as MBP, Ztag, GB1, thioredoxin, NusA, GST, or Mistic

  • Include TEV protease cleavage sites for tag removal after purification

What experimental design considerations are critical when studying HtpX substrate specificity?

When designing experiments to study HtpX substrate specificity, researchers should consider several critical factors:

Membrane Context Considerations:

  • HtpX is an integral membrane protein that cleaves substrates specifically on the cytosolic side

  • Experimental design must maintain the native membrane topology or mimic it appropriately

  • Consider using nanodiscs, liposomes, or detergent micelles to preserve the membrane environment

Substrate Selection Strategy:

  • Known substrate: SecY membrane protein has been validated as an in vivo substrate

  • Control experiments should include casein, a general protease substrate

  • Novel substrate screening should focus on misfolded membrane proteins with exposed cytoplasmic domains

Catalytic Site Manipulation:

  • Compare wild-type enzyme with catalytically ablated variants (E140A or H139F)

  • Consider using zinc chelators (e.g., EDTA) and zinc supplementation to modulate activity

  • Investigate the role of E222 in the "glutamate helix" which is essential for complementation activity

Detection Methods:

  • Design substrates with detection tags on the cytoplasmic side

  • Employ mass spectrometry for precise identification of cleavage sites

  • Consider fluorescence resonance energy transfer (FRET)-based assays to monitor cleavage in real-time

This methodological framework enables rigorous investigation of HtpX substrate specificity while accounting for its unique characteristics as an integral membrane metallopeptidase.

How do structural features of HtpX relate to its catalytic mechanism and functional specificity?

The relationship between HtpX structural features and its catalytic mechanism reveals sophisticated structure-function correlations:

Zinc-Binding Motif and Catalysis:

  • The characteristic HEXXH motif (residues 139-143) contains H139 and H143 that coordinate the catalytic zinc ion

  • E140 functions as a general base/acid during catalysis by activating the water molecule for nucleophilic attack

  • This motif is positioned on the cytosolic side of the membrane, explaining the directional specificity of substrate cleavage

Transmembrane Architecture and Substrate Access:

  • The four transmembrane segments create a specific membrane topology that positions the catalytic domain in the cytosol

  • This architecture likely creates a substrate-binding pocket that can only accommodate cytosolic portions of membrane proteins

  • The controversial localization of transmembrane segments 3 and 4 (residues 150-215) may reflect conformational flexibility relevant to substrate binding

"Glutamate Helix" Role:

  • The "glutamate helix" spanning residues 220-230 contains E222, essential for catalytic activity

  • This region likely provides the third zinc-coordinating residue required for a functional active site

  • By analogy with FACE1/Ste24p (PDB entries 2YPT/4IL3), this glutamate is critical for proper zinc coordination

Self-Cleavage Mechanism:

  • Self-cleavage occurs around position Leu260, suggesting this region becomes accessible to the active site

  • This may represent an auto-regulatory mechanism controlling HtpX activity in vivo

  • The occurrence of self-cleavage during purification suggests conformational changes upon detergent solubilization

Understanding these structural determinants is essential for interpreting experimental results and designing targeted mutations to investigate specific aspects of HtpX function.

What are the current methodological challenges in structure-function studies of HtpX, and how might they be addressed?

Structure-function studies of HtpX face several significant methodological challenges that require innovative approaches:

Challenge 1: Membrane Protein Crystallization

  • Integral membrane proteins are notoriously difficult to crystallize

  • Solution: Use of catalytically ablated mutants (E140A) purified in octyl-β-D-glucoside has shown promise

  • Advanced approach: Consider lipidic cubic phase crystallization, which has been successful for other membrane proteins

  • Alternative: Cryo-electron microscopy may circumvent crystallization requirements

Challenge 2: Active Site Structure Determination

  • The complete active site structure remains unresolved, with uncertainty about the third zinc-coordinating residue

  • Current insight: Crystal structure of a soluble fragment from V. parahaemolyticus HtpX ortholog (PDB 3CQB) provides partial information

  • Approach: Combine homology modeling with site-directed mutagenesis of predicted coordinating residues

  • Strategy: Focus on the "glutamate helix" (residues 220-230) containing E222, which is implicated in zinc coordination

Challenge 3: Tracking Conformational Dynamics

  • Understanding how HtpX recognizes and processes substrates requires insight into conformational changes

  • Technique: Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • Method: Site-specific labeling for fluorescence or EPR studies to track movement of transmembrane segments

  • Integration: Combine structural data with molecular dynamics simulations to model substrate binding and processing

Challenge 4: Establishing In Vitro Activity Assays

  • Developing robust activity assays that maintain the membrane context is challenging

  • Approach: Reconstitution of purified HtpX into proteoliposomes or nanodiscs

  • Substrates: Use fluorogenic peptides derived from known cleavage sites in SecY

  • Controls: Compare wild-type activity with E140A and H139F mutants, as well as zinc dependence

Addressing these challenges requires multidisciplinary approaches combining structural biology, biochemistry, and biophysics. The successful purification of milligram quantities of HtpX E140A mutant represents a significant advancement that paves the way for structural studies essential to understand the catalytic mechanism of this integral membrane peptidase and related family members .

How can HtpX research inform broader understanding of protein quality control mechanisms?

HtpX research provides unique insights into membrane protein quality control systems that extend beyond this specific protease:

Understanding HtpX function illuminates how cells prevent proteotoxic stress caused by accumulation of misfolded membrane proteins. This research connects to broader concepts of cellular proteostasis networks, particularly in challenging membrane environments where traditional quality control mechanisms may be limited. By studying HtpX's selective degradation of cytoplasmic regions of membrane proteins, researchers can better understand compartmentalized protein quality control strategies.

This research may reveal new principles in how membrane-bound proteases recognize misfolded substrates versus properly folded proteins—a fundamental question in protein quality control. The insights gained from HtpX studies could inform investigations of related systems in higher organisms, potentially revealing conserved mechanisms relevant to human diseases associated with membrane protein misfolding .

What experimental design considerations should be prioritized when investigating HtpX interaction with potential binding partners?

When designing experiments to investigate HtpX interactions with potential binding partners, researchers should prioritize:

Preserving Native Membrane Context:

  • Maintain HtpX in detergent micelles, nanodiscs, or proteoliposomes

  • Consider crosslinking approaches compatible with membrane environments

  • Use pull-down assays with carefully selected detergents that maintain protein-protein interactions

Identifying Physiological Interaction Partners:

  • Screen for interactions with components of other quality control systems

  • Investigate potential regulatory proteins that might control HtpX activity

  • Consider targeted approaches to identify substrates beyond the known SecY protein

Validating Interactions:

  • Use multiple orthogonal techniques (co-immunoprecipitation, surface plasmon resonance, etc.)

  • Confirm in vivo relevance through genetic approaches

  • Characterize the structural basis of interactions using purified components

Experimental Controls:

  • Compare wild-type and catalytically inactive variants to distinguish substrate vs. regulatory interactions

  • Include control membrane proteins of similar size and topology

  • Consider the impact of detergent choice on interaction stability

This methodological framework enables rigorous investigation of HtpX interactions while accounting for the complexities of membrane protein biochemistry.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.