Recombinant Shewanella loihica ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Overview

ATP synthase subunit b (atpF) forms part of the F₀ sector of the ATP synthase complex, anchoring the F₁ catalytic domain to the membrane and enabling proton translocation. The recombinant version is produced heterologously for biochemical and structural studies .

Production and Purification

The recombinant protein is synthesized in E. coli or yeast systems, followed by affinity chromatography purification. Key steps include:

  • Cloning: Full-length atpF gene (1–156 aa) inserted into expression vectors .

  • Purification: Immobilized metal-ion affinity chromatography (IMAC) for His-tagged variants .

  • Yield: Typically provided in 50 µg quantities, with customization available .

Biochemical Properties

Optimized for stability and functionality under specific conditions:

ParameterSpecification
Storage BufferTris-based buffer, 50% glycerol
Storage Temperature–20°C (short-term); –80°C (long-term)
StabilitySensitive to repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week

Functional Role in ATP Synthase

As part of the F₀ sector, subunit b:

  • Anchors the F₁ catalytic head to the membrane.

  • Facilitates proton channeling across the membrane via a rotor-stator mechanism .

  • Critical for coupling proton motive force to ATP synthesis .

Research Applications

This recombinant protein is utilized in:

  • Enzyme-Linked Immunosorbent Assays (ELISA): Detecting ATP synthase interactions .

  • Structural Studies: Resolving membrane protein assembly mechanisms .

  • Microbial Adaptation Research: Investigating Shewanella’s metabolic flexibility under extreme conditions (e.g., low temperature, high pressure) .

Genomic and Ecological Context

  • Organism Source: Shewanella loihica PV-4, isolated from iron-rich microbial mats near Hawaii .

  • Genomic Data: Complete genome sequenced (NCBI: NC_009092.1), revealing adaptations to marine environments .

  • Ecological Significance: The LIV-I transporter system in PV-4 enhances branched-chain fatty acid synthesis, aiding survival in cold, high-pressure habitats .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Shew_3849; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Target Names
atpF
Target Protein Sequence
MNINVTLIGQTVAFIIFVWFCMKFVWPPLMNAIEERQKRIADGLADADRAVKDLELAQAKATDQLKEAKATANEIIEQANKRKAQIVDEAKAEADAERAKIIAQGKAEIEAERNRVKEDLRKQVAALAIAGAEKILERSIDEAAHSDIVNKLVAEI
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) in Shewanella loihica?

ATP synthase subunit b (atpF) in Shewanella loihica is a membrane protein component of the F-type ATP synthase complex, specifically part of the F0 sector embedded in the bacterial membrane. The protein consists of 156 amino acids with the sequence beginning with "MNINVTLIGQTVAFIIF" and contains primarily hydrophobic residues in its transmembrane domain followed by more hydrophilic residues in its cytoplasmic domain . The gene encoding this protein is designated as atpF with the ordered locus name Shew_3849 in the Shewanella loihica genome . Functionally, subunit b serves as an essential component of the peripheral stalk (or stator) of the ATP synthase complex, connecting the membrane-embedded F0 sector with the catalytic F1 sector. This structural arrangement allows the enzyme to harness the proton motive force across the membrane to drive ATP synthesis.

In Shewanella loihica, the ATP synthase complex plays a crucial role in energy conservation through oxidative phosphorylation, which is considered the primary pathway for ATP synthesis in Shewanella species . The protein has several alternative designations in scientific literature, including "ATP synthase F0 sector subunit b," "ATPase subunit I," and "F-type ATPase subunit b" . Understanding the basic structure and function of atpF provides the foundation for more advanced studies on ATP synthesis mechanisms in this bacterial species.

How does ATP synthase function in Shewanella species compared to other bacteria?

Research has revealed that in S. oneidensis MR-1, the proportion of ATP produced by substrate-level phosphorylation can vary from 33% to 72.5% depending on electron acceptor availability . This flexibility distinguishes Shewanella from many other bacterial species. Interestingly, studies with S. oneidensis MR-1 mutants have shown that inactivation of the F0F1 ATP synthase operon resulted in only minor growth defects under certain anaerobic conditions, whereas disruption of the substrate-level phosphorylation pathway (Δack and Δpta mutants) severely impaired growth . This finding contrasts with many other bacterial species where F0F1 ATP synthase is essential for growth under respiratory conditions.

The architecture of the membrane region in bacterial ATP synthases, including Shewanella, demonstrates how these relatively simple bacterial complexes perform the same core functions as their more complicated mitochondrial counterparts . This structural conservation, combined with metabolic flexibility, makes Shewanella ATP synthase an interesting model system for comparative bioenergetic studies.

What is the structural organization of ATP synthase in bacteria?

The bacterial ATP synthase exhibits a conserved structural organization comprising two major sectors: the membrane-embedded F0 sector and the cytoplasmic catalytic F1 sector. Recent cryo-EM studies of bacterial ATP synthases, though not specifically of Shewanella loihica, have provided detailed insights into this organization . The F0 sector typically contains subunits a, b, and c, with multiple c subunits forming a ring structure (c-ring) in the membrane. The F1 sector consists of subunits α, β, γ, δ, and ε arranged as an α3β3 hexamer with central stalk proteins γ and ε, plus the peripheral stalk formed by subunits b and δ .

In bacterial systems, the subunit b forms a critical component of the peripheral stalk, anchoring the F1 sector to the membrane-embedded F0 sector. Unlike in mitochondrial ATP synthases, bacterial systems typically contain a simpler peripheral stalk that displays greater flexibility . The c-ring and subunit a are primarily held together by hydrophobic interactions rather than by rigid connections through the peripheral stalk, allowing for the rotational movement necessary for ATP synthesis .

The catalytic β subunits in bacterial ATP synthases adopt different conformational states during the catalytic cycle. In Bacillus PS3 ATP synthase, these have been observed as 'open', 'closed', and 'open' conformations, which differ from those seen in E. coli and mitochondrial ATP synthases . These structural differences reflect adaptations to different energetic requirements and regulatory mechanisms across species. The subunit ε also adopts specific positions that allow it to inhibit ATP hydrolysis while permitting ATP synthesis, a regulatory feature particularly important in bacterial systems .

How does the subunit b (atpF) contribute to ATP synthase function and regulation?

Subunit b (atpF) plays a sophisticated role in ATP synthase function beyond its structural contribution to the peripheral stalk. This 156-amino acid protein in Shewanella loihica contains a transmembrane N-terminal domain followed by an elongated cytoplasmic domain . The transmembrane region (approximately residues 1-24) anchors the subunit to the membrane, while the cytoplasmic portion interacts with the F1 sector, specifically with the δ subunit. This arrangement creates a rigid yet flexible connection that maintains the structural integrity of the complex during rotational catalysis.

What are the experimental approaches for studying atpF interactions with other ATP synthase subunits?

Investigating the interactions between atpF and other ATP synthase subunits requires a multi-faceted experimental approach. Researchers typically employ a combination of structural, biochemical, and genetic techniques to elucidate these complex protein-protein interactions.

Structural Biology Approaches:

  • Cryo-electron microscopy (cryo-EM) has emerged as a powerful technique for visualizing ATP synthase architecture at near-atomic resolution. This approach has successfully revealed the positions and interactions of various subunits, including b, in bacterial ATP synthases . For Shewanella loihica specifically, researchers could express and purify the complete ATP synthase complex for cryo-EM analysis, potentially using methods similar to those employed for the Bacillus PS3 enzyme expressed in E. coli .

  • X-ray crystallography of isolated subcomplexes can provide high-resolution information about specific interactions. While crystallizing membrane proteins presents challenges, researchers have succeeded with portions of the peripheral stalk.

  • Nuclear magnetic resonance (NMR) spectroscopy can be particularly useful for studying the dynamic interactions of the cytoplasmic domain of subunit b with the δ subunit and other components of the F1 sector.

Biochemical Approaches:

  • Cross-linking studies coupled with mass spectrometry can identify specific residues involved in subunit interactions. This approach has proven valuable for mapping contact points between subunit b and other components of the ATP synthase.

  • Co-immunoprecipitation and pull-down assays using recombinant Shewanella loihica atpF protein can identify binding partners and assess the strength of these interactions under different conditions.

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can provide quantitative measurements of binding affinities between atpF and other subunits, offering insights into the energetics of these interactions.

Genetic and Functional Approaches:

  • Site-directed mutagenesis of specific residues in atpF, followed by functional assays, can reveal the importance of particular amino acids in maintaining interactions with other subunits.

  • Complementation studies using S. loihica atpF mutants can assess the functional significance of specific interactions in vivo.

By integrating these approaches, researchers can develop a comprehensive understanding of how atpF contributes to ATP synthase assembly, stability, and function in Shewanella loihica.

How does ATP synthesis in Shewanella species vary under different environmental conditions?

Shewanella species exhibit remarkable metabolic versatility, adapting their energy generation mechanisms to diverse environmental conditions. This adaptability is reflected in variations in ATP synthesis pathways and the relative contributions of oxidative phosphorylation versus substrate-level phosphorylation.

Research with S. oneidensis MR-1 has demonstrated that during anaerobic growth with fumarate as the electron acceptor, substrate-level phosphorylation through the Pta-AckA pathway can contribute significantly to ATP production . Quantitative assessments revealed that under fumarate-respiring conditions, substrate-level phosphorylation provided approximately 72.5% of the ATP needed for growth, with oxidative phosphorylation contributing the remainder . This finding challenges the traditional view that respiratory organisms rely predominantly on oxidative phosphorylation for energy generation.

Most intriguingly, S. oneidensis MR-1 can also perform pyruvate fermentation, producing acetate, formate, and hydrogen as by-products . While this process does not support growth, it provides energy for cell survival in the absence of electron acceptors. The inability of pyruvate fermentation to support growth, despite generating ATP, raises important questions about the energetic requirements of Shewanella species and the regulatory mechanisms controlling their metabolism.

These metabolic adaptations likely influence the expression and activity of ATP synthase components, including atpF, under different environmental conditions. Future studies specifically examining the regulation of atpF expression and the composition of ATP synthase complexes in S. loihica across various growth conditions would provide valuable insights into how this organism optimizes its energy conservation strategies in response to environmental changes.

What are the optimal conditions for expressing and purifying recombinant Shewanella loihica atpF?

Successful expression and purification of recombinant Shewanella loihica ATP synthase subunit b (atpF) requires careful consideration of expression systems, buffer conditions, and purification strategies. Based on established protocols for similar membrane proteins and the specific characteristics of atpF, the following methodological approach is recommended:

Expression System Selection:

  • E. coli BL21(DE3) or C43(DE3) strains are often preferred for expressing membrane proteins like atpF. The C43(DE3) strain, a derivative of BL21(DE3), is particularly suitable for toxic membrane proteins.

  • Expression vectors containing T7 or tac promoters with tight regulation (such as pET series or pMAL) are recommended, with the addition of a hexahistidine or other affinity tag to facilitate purification.

  • For optimal expression, growth conditions typically include induction at OD600 of 0.6-0.8 with 0.1-0.5 mM IPTG, followed by expression at lower temperatures (16-25°C) for 4-16 hours to promote proper folding.

Membrane Extraction and Solubilization:

  • Cell lysis is typically performed using a combination of enzymatic treatment (lysozyme) and mechanical disruption (sonication or French press).

  • Membrane fraction isolation via differential centrifugation (low-speed centrifugation to remove cell debris, followed by high-speed ultracentrifugation to pellet membranes).

  • Solubilization of membrane proteins requires careful selection of detergents. For atpF, mild detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS are recommended at concentrations slightly above their critical micelle concentration.

Purification Strategy:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins as the initial purification step if using a histidine-tagged construct.

  • Size exclusion chromatography as a secondary purification step to remove aggregates and ensure homogeneity.

  • Ion exchange chromatography may be employed as an additional step if higher purity is required.

Buffer Considerations:
Based on the commercially available recombinant protein information, the optimized storage buffer for Shewanella loihica atpF consists of a Tris-based buffer with 50% glycerol . For working with the purified protein, a typical buffer might include:

  • 50 mM Tris-HCl, pH 7.5-8.0

  • 100-150 mM NaCl

  • 5-10% glycerol

  • 0.05-0.1% detergent (typically the same as used for solubilization but at a lower concentration)

  • 1 mM DTT or 2-5 mM β-mercaptoethanol to maintain reduced cysteine residues

For long-term storage, the protein should be kept at -20°C or preferably -80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week .

How can researchers assess the functional integrity of recombinant atpF?

Evaluating the functional integrity of recombinant Shewanella loihica ATP synthase subunit b (atpF) is essential for ensuring that experimental results accurately reflect the protein's native properties. Several complementary approaches can be employed:

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy can provide information about the secondary structure content of purified atpF. The expected profile would show characteristics of an alpha-helical protein, particularly in the cytoplasmic domain.

  • Thermal shift assays (differential scanning fluorimetry) can assess protein stability under various buffer conditions, helping to optimize storage and experimental conditions.

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can confirm the oligomeric state of the protein, as subunit b typically forms a dimer (b2) in bacterial ATP synthases.

Functional Interaction Studies:

  • In vitro binding assays with purified partner subunits (particularly the δ subunit) can confirm that recombinant atpF retains its ability to form specific interactions. Surface plasmon resonance (SPR) or microscale thermophoresis (MST) are particularly suitable for quantifying these interactions.

  • Reconstitution experiments combining purified atpF with other ATP synthase components to assess complex formation capacity. This can be analyzed using blue native PAGE or analytical ultracentrifugation.

  • Liposome reconstitution followed by proton pumping assays, where atpF is incorporated into liposomes along with other F0 components to test for functional assembly of the proton channel.

In Vivo Complementation:

  • Complementation studies using atpF-deficient bacterial strains can provide the most definitive evidence of functional integrity. If recombinant Shewanella loihica atpF can rescue the growth phenotype of such strains under respiratory conditions, this strongly indicates that the protein is functionally intact.

  • Construction of chimeric ATP synthases, where the native atpF in E. coli or another model organism is replaced with the Shewanella loihica version, can demonstrate functional compatibility and highlight any species-specific functional differences.

By combining these approaches, researchers can comprehensively evaluate whether their recombinant atpF preparation retains the structural and functional properties necessary for meaningful experimental studies of ATP synthase assembly, regulation, and activity.

What techniques are available for studying the assembly and dynamics of ATP synthase complexes?

Investigating the assembly and dynamics of ATP synthase complexes containing subunit b (atpF) requires sophisticated methodological approaches that can capture both structural details and temporal changes. Several cutting-edge techniques have proven particularly valuable:

Advanced Imaging Techniques:

  • Single-particle cryo-electron microscopy (cryo-EM) has revolutionized our understanding of ATP synthase structure by enabling visualization of the complete complex in different rotational states . This technique can resolve conformational changes associated with the catalytic cycle, including movements of the peripheral stalk containing subunit b.

  • Electron tomography of ATP synthases in native membranes can provide insights into the spatial organization and potential dimerization or oligomerization of the complexes.

  • Super-resolution fluorescence microscopy (such as PALM or STORM) using fluorescently labeled subunits can track the distribution and dynamics of ATP synthase complexes in living cells.

Real-time Monitoring of Assembly and Dynamics:

  • Pulse-chase experiments combined with blue native PAGE or immunoprecipitation can track the kinetics of ATP synthase assembly in vivo, revealing the order of subunit incorporation and any assembly intermediates.

  • Förster resonance energy transfer (FRET) between fluorescently labeled subunits can monitor protein-protein interactions in real-time, providing information about both assembly and conformational dynamics during catalysis.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of proteins that undergo conformational changes or become protected upon complex formation, offering insights into the dynamics of subunit interactions.

Computational and Hybrid Approaches:

  • Molecular dynamics simulations based on structural data can model the dynamic behavior of subunit b and its interactions with other components of the ATP synthase.

  • Coarse-grained simulations can extend the timescale of these analyses to capture larger conformational changes relevant to the catalytic cycle.

  • Integrative modeling approaches combining data from multiple experimental techniques (cryo-EM, cross-linking mass spectrometry, FRET) can generate comprehensive models of ATP synthase assembly and dynamics.

By applying these techniques to the study of Shewanella loihica ATP synthase, researchers can develop a dynamic picture of how subunit b contributes to both the structural integrity and functional mechanics of this sophisticated molecular machine. The resulting insights may reveal adaptation-specific features that contribute to the remarkable metabolic versatility of Shewanella species across diverse environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.