Recombinant Shewanella loihica Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Shewanella loihica and Disulfide Bond Formation

Shewanella loihica is a Gram-negative bacterium originally isolated from an iron-rich microbial mat in the Pacific Ocean near Hawaii . The type strain, designated as PV4 (DSM 17748, ATCC BAA-1088, CIP 109777), was collected in September 1997 . Like other members of the Shewanella genus, S. loihica is noted for its diverse respiratory capabilities, particularly its ability to reduce metals, making it significant for bioremediation applications and understanding extracellular electron transfer processes .

Disulfide bonds, formed by the oxidation of pairs of cysteines, are crucial for the folding and stability of many exported proteins in bacteria . In bacterial systems, particularly the well-studied Escherichia coli, disulfide bond formation is facilitated by a pathway involving the periplasmic protein DsbA and the membrane-bound protein DsbB . This system operates as follows:

  1. DsbA introduces disulfide bonds into proteins translocated into the periplasm

  2. The membrane-bound DsbB reoxidizes DsbA, restoring its activity

  3. DsbB transfers electrons to the electron transport chain via membrane-bound quinones

Table 2: Comparison of DsbB Proteins from Different Shewanella Species

FeatureS. loihica DsbBShewanella sp. DsbB
UniProt IDA3QEZ4A0KVP7
Length171 amino acids175 amino acids
Active site motifCXXC presentCXXC present
N-terminal regionMSALTRFAQSRMTAFTRFAHSR
Expression systemE. coliE. coli
TagN-terminal HisN-terminal His

Role in Bacterial Adaptation

Members of the Shewanella genus, including S. loihica, are known for their remarkable respiratory versatility and ability to thrive in diverse environments . The proper functioning of the disulfide bond formation system, including DsbB, is likely critical for maintaining the structural integrity and function of extracellular and periplasmic proteins involved in these adaptive processes.

Potential Applications

The recombinant S. loihica DsbB protein has several potential applications:

  1. Basic Research: Studying bacterial disulfide bond formation mechanisms

  2. Protein Engineering: Developing improved systems for disulfide bond formation in heterologous proteins

  3. Biotechnology: Enhancing the production of disulfide-bonded recombinant proteins

  4. Environmental Applications: Supporting research on Shewanella's metal reduction capabilities, which have implications for bioremediation

Research Tools and Methods

Recent advances in genetic tools for Shewanella species have expanded the possibilities for studying proteins like DsbB in their native context. For instance, the development of efficient electroporation methods and recombineering systems for Shewanella oneidensis may be adaptable to S. loihica, enabling more precise genetic manipulation and functional studies .

Comparative Analysis with Other Disulfide Bond Formation Systems

Bacteria exhibit diversity in their mechanisms of disulfide bond formation. While many Proteobacteria (the phylum containing Shewanella) possess both DsbA and DsbB homologs, suggesting similar redox biology, some other bacterial groups use alternative systems .

Interestingly, some bacteria predicted to catalyze disulfide bond formation lack DsbB homologs despite having DsbA homologs. This observation suggests that alternative mechanisms for reoxidizing DsbA exist in these organisms . This diversity highlights the evolutionary adaptability of disulfide bond formation systems and raises interesting questions about the specific adaptations in the S. loihica system.

Future Research Directions

Several promising avenues for future research on S. loihica DsbB include:

  1. Detailed structural characterization using crystallography or cryo-EM

  2. Functional studies to determine substrate specificity and kinetic parameters

  3. Investigation of its role in S. loihica's metal reduction capabilities

  4. Exploration of its potential for enhancing heterologous protein production

  5. Comparative studies with DsbB proteins from other Shewanella species and more distantly related bacteria

Such research would not only enhance our understanding of bacterial disulfide bond formation but could also lead to practical applications in biotechnology and environmental science.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with normal blue ice packs. If dry ice packaging is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it.
Synonyms
dsbB; Shew_2176; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Target Names
dsbB
Target Protein Sequence
MSALTRFAQSRLAWTLLLLTAVGLEACALFFQHVMKLDPCVMCIYQRLAVLGVLTAGLIG VVGHQFRLLRFLGVLLWGVSAAWGLKLALELVEMQTNPSPFSTCSFLPEFPEWMPLHEWF PSVFLPTGMCTDIPWEMFGITMSQWMVVAFSTYLIALVVFIVPALMPTKKA
Uniprot No.

Target Background

Function
Required for disulfide bond formation in some periplasmic proteins. Acts by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella loihica dsbB and what are its key characteristics?

Shewanella loihica dsbB (Disulfide bond formation protein B) is a membrane protein that functions as a disulfide oxidoreductase, playing a crucial role in the formation of disulfide bonds in proteins. The protein is encoded by the dsbB gene (locus name Shew_2176) and has a UniProt accession number of A3QEZ4. The full-length protein consists of 171 amino acids and is typically studied as part of the bacterium's extracellular electron transfer mechanisms .

Shewanella loihica PV-4 is classified as an electricigen, meaning it can produce electricity by transferring electrons to external acceptors. This capability makes it valuable for research in bioelectrochemical systems (BES) where the extracellular electron transfer (EET) rate is critical for current output .

What are the recommended storage conditions for recombinant dsbB?

Proper storage is crucial for maintaining protein stability and activity. For recombinant Shewanella loihica dsbB, the following storage conditions are recommended:

Storage PurposeTemperatureBuffer CompositionAdditional Notes
Long-term storage-20°C to -80°CTris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% Trehalose, pH 8.0Aliquoting is necessary for multiple use
Working stock4°CSame as storage bufferStable for up to one week
Reconstitution-Deionized sterile waterReconstitute to 0.1-1.0 mg/mL

Repeated freezing and thawing is not recommended as it can compromise protein integrity and activity. For extended storage, it's advisable to add glycerol (final concentration 30-50%) and store aliquots at -20°C or -80°C .

How does dsbB function in the context of Shewanella loihica's electron transfer capabilities?

In Shewanella loihica, dsbB is involved in the proper folding of proteins by catalyzing disulfide bond formation, which is particularly important for the structure and function of outer membrane cytochromes (OMCs) that participate in extracellular electron transfer (EET).

Shewanella loihica PV-4 employs two primary mechanisms for EET:

  • Direct Electron Transfer (DET): Involves direct contact between cell-surface proteins (primarily cytochromes) and the electrode surface

  • Mediated Electron Transfer (MET): Utilizes soluble mediators, particularly flavins, to shuttle electrons between cells and electrodes

Research has shown that at lower electrode potentials, Shewanella loihica primarily utilizes flavin-mediated EET, while at higher potentials, both DET and MET contribute to the current output. This dual capability makes Shewanella loihica an interesting model organism for studying bacterial electricity production .

What expression systems are optimal for recombinant dsbB production?

Based on established protocols, E. coli expression systems have been successfully employed for recombinant Shewanella loihica dsbB production. When designing an expression system, researchers should consider:

Expression SystemAdvantagesConsiderations
E. coli with His-tagEasy purification, high yieldPotential interference with membrane insertion
E. coli with native sequenceMore natural protein foldingMore complex purification process
Homologous expression in ShewanellaNative post-translational modificationsLower yield, technically more challenging

For most research applications, recombinant dsbB with an N-terminal His-tag expressed in E. coli provides a good balance between yield and functionality. This approach allows for effective purification using immobilized metal affinity chromatography (IMAC) .

How can I verify the purity and activity of recombinant dsbB?

Verifying the purity and activity of recombinant dsbB is essential before proceeding with experiments. The following methods are recommended:

  • Purity assessment: SDS-PAGE analysis should show greater than 90% purity, with dsbB appearing at the expected molecular weight .

  • Western blotting: Using antibodies against the tag (e.g., His-tag) or dsbB itself to confirm identity.

  • Activity assay: While specific activity assays for dsbB may vary depending on research context, functional assays typically involve:

    • Measuring disulfide bond formation in substrate proteins

    • Assessing the protein's ability to complement dsbB-deficient strains

    • Evaluating electron transfer capabilities in bioelectrochemical systems

What are key considerations for designing biofilm experiments with Shewanella loihica?

When designing biofilm experiments with Shewanella loihica for studying dsbB function and electron transfer mechanisms, consider the following factors:

  • Electrode material selection: Reticulated vitreous carbon (RVC) electrodes have been shown to increase surface area available for biofilm formation compared to conventional flat electrodes .

  • Electrode potential: Research has demonstrated that electrode potential significantly affects cell attachment, biofilm formation, and the balance between DET and MET mechanisms:

    • Higher electrode potentials favor cell attachment on electrodes

    • DET is the prevailing mechanism in early biofilm development

    • MET contribution increases as biofilm matures

  • Biofilm age: The maturity of the biofilm affects the dominant electron transfer mechanisms, with older biofilms showing increased reliance on mediator-based electron transfer .

  • Environmental conditions: Oxygen availability significantly impacts protein expression profiles, with proteins involved in anaerobic energy metabolism showing up to 10-fold increases when transitioning from aerobic to suboxic conditions .

How do electrode potential and biofilm age affect extracellular electron transfer mechanisms?

Research on Shewanella loihica PV-4 has revealed complex relationships between electrode potential, biofilm age, and extracellular electron transfer (EET) mechanisms:

ConditionDominant EET MechanismObservations
Low electrode potentialFlavin-mediated METLower current output, less biofilm formation
High electrode potentialCombined DET and METEnhanced cell attachment, higher current output
Early biofilmPrimarily DETDirect contact between cells and electrode
Mature biofilmIncreased MET contributionMediators may become confined within biofilm

This dynamic relationship demonstrates that experimental conditions must be carefully controlled and reported when studying Shewanella loihica electron transfer capabilities. Electrode potential should be considered a critical variable that influences both biofilm formation and the underlying molecular mechanisms of electron transfer .

What proteomics approaches are most effective for studying dsbB and related proteins?

Based on research with Shewanella species, the following proteomics approaches have proven effective:

  • LC-MS without stable isotope labeling: This approach has been successfully applied for differential quantitative proteomic analysis of Shewanella whole cell lysates under varying conditions (aerobic vs. suboxic) .

  • LC-MS/MS for peptide identification: This technique enables identification of peptide sequences with high confidence .

  • LC-FTICR for quantification: Fourier transform ion cyclotron resonance mass spectrometry provides both confirmation of identifications and precise measurement of relative peptide abundances .

Using these techniques, researchers have identified and quantified thousands of peptides covering hundreds of proteins in Shewanella species. This approach revealed significant changes in protein abundance (up to 10-fold) when transitioning between aerobic and anaerobic conditions, particularly for proteins involved in energy metabolism .

How do aerobic versus anaerobic conditions affect protein expression in Shewanella loihica?

Proteomic analysis has revealed substantial differences in protein expression between aerobic and suboxic/anaerobic conditions in Shewanella species:

  • Proteins involved in anaerobic energy metabolism: Show up to 10-fold increases in relative abundance when transitioning from aerobic to suboxic conditions .

  • Housekeeping proteins: Remain relatively unchanged in abundance regardless of oxygen availability .

  • Electron transfer proteins: Cytochromes and associated proteins show significant upregulation under anaerobic conditions to facilitate alternative respiratory pathways .

These findings highlight the importance of carefully controlling and reporting oxygen levels in experiments involving Shewanella loihica, as oxygen availability dramatically affects the expression of proteins involved in electron transfer pathways.

What are common issues in dsbB purification and how can they be resolved?

Several challenges may arise during the purification and handling of recombinant dsbB:

IssuePossible CausesSolutions
Low protein yieldSuboptimal expression conditions, protein aggregationOptimize induction parameters, use detergents for membrane protein extraction
Protein inactivityImproper folding, loss of cofactorsInclude appropriate cofactors in buffers, optimize purification conditions
Precipitation during storageProtein instability, buffer incompatibilityAdd glycerol or trehalose, adjust buffer composition
Inconsistent experimental resultsProtein batch variation, degradationImplement rigorous quality control, prepare fresh aliquots

For recombinant dsbB specifically, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with added glycerol (30-50% final concentration) is recommended to maintain protein stability .

How should contradictory data in dsbB research be approached?

When facing contradictory results in dsbB research, consider the following methodological approach:

What statistical approaches are appropriate for analyzing dsbB-related experimental data?

When designing experiments and analyzing data related to dsbB function in Shewanella loihica, consider these statistical approaches:

  • For comparing treatment groups: Analysis of variance (ANOVA) for multiple comparisons or t-tests for paired comparisons between specific conditions.

  • For time-series data: Repeated measures ANOVA or mixed-effects models to account for temporal correlations.

  • For biofilm analyses: Consider spatial statistics to account for the heterogeneous distribution of bacteria observed in biofilms, particularly their preference for flat areas of electrode surfaces .

  • For proteomics data: Statistical approaches such as statistical analysis of microarrays have been effectively used to identify proteins with significantly changed abundance levels in Shewanella species .

  • Sample size determination: Conduct power analyses before experiments to ensure sufficient statistical power for detecting meaningful differences between conditions.

What are emerging applications of dsbB research in bioelectrochemical systems?

The study of dsbB and related proteins in Shewanella loihica has significant implications for advancing bioelectrochemical systems (BES) with several promising research directions:

  • Enhancing current output: Understanding how dsbB affects the formation and function of electron transfer proteins could lead to engineered strains with improved electricity generation capabilities.

  • Biofilm optimization: Knowledge of how electrode potential affects biofilm formation and EET mechanisms can inform the design of more efficient microbial fuel cells.

  • Mediator engineering: Insights into the transition between DET and MET mechanisms could enable the development of artificial mediators or engineered cells with enhanced electron transfer capabilities.

  • Environmental applications: Optimized Shewanella loihica systems could be applied to waste treatment, bioremediation, and sustainable energy production.

The continued study of proteins like dsbB is essential for bridging the gap between fundamental molecular mechanisms and practical applications of electricigens in bioelectrochemical systems.

How might systems biology approaches advance our understanding of dsbB function?

Integrating multiple omics approaches could provide a more comprehensive understanding of dsbB function within the broader context of Shewanella loihica physiology:

  • Multi-omics integration: Combining proteomics, transcriptomics, and metabolomics data to understand how dsbB expression correlates with other cellular processes.

  • Protein interaction networks: Identifying protein-protein interactions involving dsbB to elucidate its role in electron transfer pathways.

  • Comparative genomics: Analyzing dsbB homologs across different Shewanella species and other electricigens to identify conserved features and specialized adaptations.

  • Mathematical modeling: Developing quantitative models of electron transfer that incorporate dsbB function to predict system behavior under various conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.