Recombinant Shewanella loihica Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Biochemical Characterization of Recombinant PlsY

Recombinant PlsY from Shewanella loihica (strain PV-4) has been produced in Escherichia coli with N-terminal His tags for purification and functional studies. Key properties include:

PropertyDetails
UniProt IDA3QBM4 (strain PV-4), Q0HSD6, A1RMH7 (other Shewanella sp. variants)
Molecular Weight24–26 kDa (predicted for 203 amino acids)
Expression SystemE. coli
StorageTris-based buffer with 50% glycerol; stable at -20°C/-80°C
Amino Acid SequenceConserved domains: LPDPRSQGSGNPGATNVLRIGGAS (acyltransferase motif)

Functional Role in Fatty Acid Biosynthesis

PlsY initiates the first step of glycerophospholipid synthesis by transferring an acyl group from acyl-phosphate to glycerol-3-phosphate. Its activity is pivotal in:

  • Membrane Adaptation: Enables Shewanella species to synthesize branched-chain fatty acids (BCFA) and polyunsaturated fatty acids (e.g., eicosapentaenoic acid, EPA) for low-temperature and high-pressure adaptation .

  • Regulatory Mechanisms:

    • LIV-I Transporter Interaction: In S. loihica PV-4, PlsY collaborates with the LIV-I branched-chain amino acid transporter to enhance BCFA synthesis under cold stress. This system is horizontally acquired and exclusive to cold-adapted Shewanella strains .

    • Substrate Specificity: Prefers polyunsaturated acyl donors (e.g., eicosapentaenoyl-CoA) over saturated ones, facilitating EPA-rich membrane synthesis .

Table 1: Key Studies on PlsY Functionality

ConditionObservationSource
Low Temperature (4°C)Increased BCFA and EPA production; LIV-I transporter upregulation enhances substrate uptake for PlsY .
High Pressure (20 MPa)Synergistic effect with low temperature to elevate EPA content by 40% .
Gene Knockout (ΔplsY)Impaired growth under cold/high-pressure conditions; membrane rigidity observed

Applications in Biotechnology

  • Industrial Enzyme Production: Recombinant PlsY is commercially available for lipid metabolism research, sold as lyophilized or liquid formulations (>90% purity) .

  • Bioengineering: Used to engineer microbial strains for EPA production, leveraging its substrate preference for polyunsaturated fatty acids .

  • Environmental Studies: Serves as a biomarker for cold adaptation in deep-sea bacteria .

Evolutionary and Genomic Insights

  • Horizontal Gene Transfer: The LIV-I-PlsY regulatory cluster in S. loihica PV-4 shows atypical dinucleotide bias (δ* > 88%) and G+C content divergence, indicating acquisition via horizontal transfer .

  • Taxonomic Distribution: PlsY homologs are conserved in Alteromonadales and Vibrionales but absent in non-cold-adapted Shewanella strains .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will prepare according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
plsY; Shew_1001; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Target Names
plsY
Target Protein Sequence
MSLTLLTLAMILTAYLAGSISSAVLVCRLRGLPDPRSQGSGNPGATNVLRIGGASAAAMV LLFDMLKGAVPAYVAFRLGVDAVSLGVIAIAACLGHIFPIFFKFKGGKGVATAFGAMAPI GADLSLALIATWVIVVLICRYSSLAAIVTALLAPAYTWYFDERFTVPVAMLSLLIIIRHK ENIHRLLKGEESKVSRKKRTDGN
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) in Shewanella loihica and what is its biological function?

Glycerol-3-phosphate acyltransferase (plsY) in Shewanella loihica is an enzyme encoded by the plsY gene (Shew_1001) that catalyzes a critical step in phospholipid biosynthesis. It functions as an acyl-phosphate--glycerol-3-phosphate acyltransferase (EC 2.3.1.n3), transferring acyl groups to glycerol-3-phosphate to form lysophosphatidic acid, a precursor in membrane phospholipid synthesis. The enzyme is also referred to as Acyl-PO4 G3P acyltransferase or GPAT in the scientific literature .

In Shewanella loihica, plsY plays a crucial role in maintaining membrane integrity, especially under varying environmental conditions, including anaerobic respiration scenarios. The enzyme contributes to the remarkable metabolic versatility of Shewanella species, which are known for their ability to use diverse electron acceptors, including metal oxides .

What analytical methods are recommended for initial plsY activity assessment?

For initial plsY activity assessment, researchers should consider enzyme kinetics approaches similar to those used for other transferases. A standard assay would measure the rate of acyl transfer from acyl-phosphate to glycerol-3-phosphate under controlled conditions.

Recommended procedure:

  • Prepare reaction buffer (typically Tris-based, pH 7.5)

  • Set up reaction mixtures with varying substrate concentrations

  • Add purified recombinant plsY enzyme (typically 50-100 ng)

  • Incubate at optimal temperature (30-37°C)

  • Quench reactions at predetermined time points

  • Analyze product formation using HPLC or mass spectrometry

The enzyme activity can be calculated using the Michaelis-Menten equation to determine kinetic parameters Km and Vmax. When analyzing data, use statistical approaches similar to those outlined for biochemical experiments, with appropriate controls to account for background activities6.

How does the cAMP/CRP-dependent regulatory system affect plsY gene expression in Shewanella loihica under different respiratory conditions?

The cAMP/CRP-dependent regulatory system likely influences plsY expression through complex regulatory networks, particularly during shifts between aerobic and anaerobic metabolism. In Shewanella species, the cAMP/CRP system functions primarily in regulating anaerobic respiration rather than carbon catabolite repression (as in E. coli) .

Evidence suggests that CRP is required for transcriptional activation of genes involved in electron acceptor reduction, including metal oxides. Though plsY is not directly mentioned in this regulatory network, its role in membrane phospholipid synthesis likely places it under regulatory control during respiratory shifts. The regulation may involve interactions between CRP and other regulators like ArcA and Fnr, which have been shown to interactively control gene expression in Shewanella oneidensis MR-1 .

To investigate this relationship experimentally, researchers should:

  • Generate CRP knockout mutants in Shewanella loihica

  • Measure plsY transcription levels under aerobic vs. anaerobic conditions using RT-qPCR

  • Perform chromatin immunoprecipitation (ChIP) to determine if CRP directly binds to the plsY promoter region

  • Analyze the effects of exogenous cAMP addition on plsY expression

What role does plsY play in Shewanella loihica's adaptation to electrochemical environments?

Shewanella loihica's remarkable ability to adapt to electrochemical environments likely involves membrane remodeling, in which plsY would play a crucial role through phospholipid biosynthesis. Studies have shown that S. loihica PV-4's TCA-cycle activity can be modified by changing electrode potential in electrochemical cells . This metabolic shift would necessitate corresponding changes in membrane composition to optimize electron transfer processes.

The enzyme may contribute to:

  • Altering membrane fluidity in response to redox conditions

  • Supporting the integration of electron transport proteins in the membrane

  • Facilitating the organization of extracellular electron transfer (EET) components

A comprehensive investigation would require:

  • Comparing plsY expression levels at different electrode potentials

  • Analyzing membrane phospholipid composition in wild-type vs. plsY-modified strains

  • Examining the spatial relationship between plsY activity and EET components

  • Measuring electron transfer rates in relation to plsY expression levels

How can CRISPR-Cas9 be utilized to study plsY function in Shewanella loihica?

CRISPR-Cas9 offers a powerful approach to precisely investigate plsY function through targeted gene modification. Based on experimental approaches mentioned in the search results6, a systematic CRISPR-based strategy would involve:

  • Design and cloning of sgRNA targeting plsY:

    • Identify unique target sequences within the plsY gene

    • Clone sgRNA sequences into appropriate vectors for Shewanella transformation

    • Validate vector construction through sequencing

  • Transformation and mutation strategy:

    • Transform Shewanella loihica with both the sgRNA-containing plasmid and a repair template

    • The repair template should contain desired mutations or modifications (point mutations, tags, etc.)

    • Select transformants using appropriate antibiotic markers

  • Mutation verification:

    • Isolate genomic DNA from transformed colonies

    • Perform PCR amplification of the targeted region

    • Verify mutations through sequencing

    • Confirm protein expression changes through Western blotting

  • Phenotypic analysis:

    • Compare growth rates under various conditions

    • Analyze membrane phospholipid profiles

    • Assess electron transfer capabilities in mutant strains

What are the optimal conditions for expressing and purifying recombinant Shewanella loihica plsY?

The optimal conditions for expressing and purifying recombinant Shewanella loihica plsY would include:

Expression system recommendations:

  • E. coli BL21(DE3) or similar strain optimized for membrane protein expression

  • Expression vector with inducible promoter (T7 or tac)

  • Growth temperature of 16-20°C after induction to increase soluble protein yield

  • Consider fusion tags (His6, GST) for purification, positioning them to avoid interference with catalytic activity

Purification protocol:

  • Cell lysis using sonication or French press in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, and appropriate protease inhibitors

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization using mild detergents (0.5-1% DDM or CHAPS)

  • Affinity chromatography using the fusion tag

  • Size exclusion chromatography for final purification

Storage conditions:
Store in Tris-based buffer with 50% glycerol at -20°C for extended storage, as indicated for similar proteins .

What experimental design approaches are most effective for studying plsY kinetics?

An effective experimental design for studying plsY kinetics should include the following key elements:

  • Clearly defined variables:

    • Independent variable: Substrate concentrations (acyl-phosphate, glycerol-3-phosphate)

    • Dependent variable: Reaction rate or product formation

    • Control variables: Temperature, pH, ionic strength

  • Substrate concentration ranges:

    SubstrateConcentration RangeIncrements
    Acyl-phosphate0.1-10 mM5-7 points, logarithmic scale
    Glycerol-3-phosphate0.1-10 mM5-7 points, logarithmic scale
  • Time course measurements:

    • Multiple time points (0, 1, 2, 5, 10, 15, 20 min)

    • Ensure linearity of product formation

  • Analysis approach:

    • Use Michaelis-Menten, Lineweaver-Burk, and Eadie-Hofstee plots

    • Apply non-linear regression to determine kinetic parameters

    • Consider using global fitting for complex kinetic models

  • Controls and replicates:

    • No-enzyme controls

    • Heat-inactivated enzyme controls

    • Minimum of three independent replicates

    • Technical triplicates within each experiment

How can researchers effectively analyze the impact of environmental factors on plsY activity?

To effectively analyze the impact of environmental factors on plsY activity, researchers should implement a multifactorial experimental design approach:

  • Systematic variation of environmental parameters:

    ParameterRange to TestRelevance
    pH5.0-9.0 (0.5 increments)Influences protein ionization and catalytic efficiency
    Temperature10-50°C (5°C increments)Affects protein conformation and reaction rates
    Ionic strength50-500 mM NaClMimics marine environment variations
    Redox potential-400 to +200 mVSimulates electrochemical environments
  • Statistical analysis approach:

    • Employ factorial design to identify interaction effects

    • Use response surface methodology to identify optimal conditions

    • Apply ANOVA to determine statistical significance of each factor4

  • Data visualization:

    • Generate heat maps showing activity across parameter combinations

    • Create 3D response surface plots for multifactorial analysis

    • Use statistical tables formatted according to research publication standards4

  • Correlation with in vivo conditions:

    • Compare in vitro findings with physiological conditions

    • Analyze gene expression data alongside enzyme activity

    • Consider membrane microdomain effects on enzyme function

How should researchers interpret discrepancies between predicted and observed plsY activity in Shewanella loihica?

When encountering discrepancies between predicted and observed plsY activity, researchers should systematically evaluate several potential factors:

  • Post-translational modifications:

    • Examine if the native enzyme undergoes phosphorylation, acetylation, or other modifications

    • Compare recombinant enzyme with native enzyme isolated from Shewanella loihica

    • Consider modifications that might occur in response to environmental conditions

  • Protein-protein interactions:

    • Investigate if plsY functions in a complex with other proteins

    • Perform pull-down assays to identify potential interacting partners

    • Assess if activity changes in the presence of cell extracts

  • Allosteric regulation:

    • Test activity in the presence of potential metabolic regulators

    • Examine substrate inhibition or activation phenomena

    • Generate substrate saturation curves under various conditions

  • Technical considerations:

    • Validate assay methodology with known controls

    • Ensure enzyme preparation maintains structural integrity

    • Check for interfering compounds in reaction mixtures

A systematic analysis using the above framework will help distinguish between biological phenomena and technical artifacts.

What are the common pitfalls in plsY research and how can they be avoided?

Based on general principles in enzyme research, common pitfalls and their solutions include:

PitfallManifestationPrevention Strategy
Protein insolubilityLow yield, aggregationUse specialized membrane protein expression systems; optimize detergent screening
Enzyme instabilityDeclining activity over timeInclude stabilizing agents (glycerol, specific lipids); optimize storage conditions
Substrate limitationsNon-physiological kineticsTest multiple substrate analogs; consider natural substrate composition
Assay interferenceBackground signal, inconsistent resultsInclude appropriate controls; validate assay with known standards
Neglecting membrane environmentActivity inconsistent with in vivo dataReconstitute enzyme in liposomes; test activity in native-like membrane environment

Additionally, when designing experiments involving plsY:

  • Ensure enzyme purity through rigorous chromatography steps

  • Validate functional integrity before kinetic studies

  • Consider the lipid environment's effect on activity

  • Account for potential cofactor requirements not identified in sequence analysis

How can multivariate analysis be applied to understand plsY function in the context of Shewanella loihica's metabolism?

Multivariate analysis offers powerful approaches to understand plsY function within Shewanella loihica's complex metabolism:

  • Integrated omics approach:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Track correlations between plsY expression and metabolic changes

    • Identify co-regulated genes through clustering algorithms

  • Flux balance analysis:

    • Develop a genome-scale metabolic model incorporating plsY

    • Simulate the effects of varying plsY activity on metabolic flux distribution

    • Predict growth phenotypes under different conditions

  • Principal Component Analysis (PCA):

    • Reduce dimensionality of multivariate datasets

    • Identify key variables influencing plsY function

    • Visualize relationships between experimental conditions

  • Statistical analysis framework:

    • Use multiple regression to identify predictors of plsY activity

    • Apply machine learning algorithms to identify patterns in complex datasets

    • Validate predictive models through experimental verification

When analyzing results, researchers should consider the broader metabolic context, including the connections between phospholipid synthesis and electron transfer processes that are central to Shewanella's unique respiratory capabilities .

How might plsY function contribute to Shewanella loihica's potential in microbial fuel cells?

Shewanella loihica's application in microbial fuel cells (MFCs) represents an exciting frontier where plsY function may play a crucial role. Research suggests that S. loihica PV-4 demonstrates Coulombic efficiency of approximately 26% in lactate-fed air-cathode MFCs, higher than the 16% observed in S. oneidensis MR-1 .

The plsY enzyme likely contributes to MFC performance through:

  • Membrane composition optimization:

    • Tailoring phospholipid composition to support electron transfer proteins

    • Maintaining membrane integrity under varying electrode potentials

    • Facilitating interaction with extracellular electron acceptors

  • Metabolic adaptation mechanisms:

    • Supporting metabolic shifts in response to electrode potential changes

    • Contributing to membrane restructuring when TCA cycle activity changes

    • Enabling energy conservation during electron transfer processes

  • Research approaches to investigate this relationship:

    • Create plsY variants with altered activity and assess MFC performance

    • Analyze membrane phospholipid profiles at different electrode potentials

    • Correlate plsY expression levels with electron transfer rates and power output

    • Investigate the spatial organization of plsY-dependent membrane domains in electrode-attached biofilms

What novel experimental techniques could advance our understanding of plsY regulation in Shewanella loihica?

Advancing our understanding of plsY regulation will require innovative experimental approaches:

  • CRISPRi for tunable gene repression:

    • Implement CRISPR interference to create partial knockdowns

    • Generate expression gradients to identify threshold effects

    • Study dosage relationships between plsY and interacting genes

  • Optogenetic control systems:

    • Develop light-responsive promoters for temporal control of plsY expression

    • Study dynamic responses to rapid expression changes

    • Investigate spatial regulation within bacterial communities

  • Single-cell techniques:

    • Apply single-cell RNA-seq to identify cell-to-cell variability in plsY expression

    • Use microfluidics to study response dynamics at the single-cell level

    • Implement fluorescent reporters to track plsY expression in real-time

  • In situ structural studies:

    • Apply cryo-electron tomography to visualize plsY in the membrane context

    • Use in-cell NMR to monitor structural changes under different conditions

    • Develop proximity labeling approaches to map protein-protein interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.