Recombinant Shewanella loihica Lipoprotein signal peptidase (lspA)

What is Lipoprotein signal peptidase (lspA) and what is its functional role in bacterial physiology?

Lipoprotein signal peptidase (lspA) is an essential aspartyl protease that specifically catalyzes the removal of signal peptides from prolipoproteins as part of the lipoprotein-processing pathway. The enzyme functions by cleaving the transmembrane helix signal peptide of lipoproteins after they have been modified with lipids . This processing is critical for bacterial cell envelope biogenesis and maintenance.

The lspA protein from Shewanella loihica belongs to the peptidase A8 family and consists of 170 amino acids with a molecular mass of approximately 19.4 kDa . The enzyme is embedded in the bacterial membrane where it conducts its catalytic activity. The functional importance of lspA is underscored by the fact that it is essential in Gram-negative bacteria and plays a significant role in virulence for Gram-positive bacteria .

What expression systems are most effective for recombinant Shewanella loihica lspA production?

Escherichia coli expression systems are predominantly used for the recombinant production of lspA proteins, including those from Shewanella species. The expression methodology typically involves:

• Gene cloning into an appropriate expression vector with an affinity tag (commonly His-tag)

• Transformation into an E. coli expression strain

• Induction of protein expression under optimized conditions

• Cell harvesting and lysis

• Membrane fraction isolation (as lspA is a membrane protein)

For example, recombinant full-length Shewanella oneidensis lspA protein has been successfully expressed in E. coli with an N-terminal His tag . The expression and purification protocols often need optimization to address the challenges associated with membrane protein production, including:

• Appropriate detergent selection for solubilization

• Prevention of protein aggregation

• Maintenance of proper folding and activity

What purification strategies yield the highest purity for recombinant lspA proteins?

Purification of recombinant lspA typically involves a multi-step approach to achieve high purity (>90%) as determined by SDS-PAGE . An effective purification workflow includes:

For membrane proteins like lspA, the entire purification process must be conducted in the presence of appropriate detergents to maintain protein solubility and native conformation. The choice of detergent is critical, as demonstrated in studies where even small amounts of solvents like DMSO can significantly impact the protein's conformation and activity .

How is the activity of purified recombinant lspA typically assessed?

The enzymatic activity of purified recombinant lspA can be assessed through multiple approaches:

• In vitro cleavage assays: Using synthetic peptide substrates that mimic the natural prolipoprotein cleavage site

• Mass spectrometry: To detect and quantify the cleaved peptide products

• Fluorescence-based assays: Employing substrates with fluorescence resonance energy transfer (FRET) pairs that change signal upon cleavage

• Inhibition studies: Measuring activity in the presence of known inhibitors like globomycin

When designing activity assays, researchers must consider that lspA's natural environment is within the membrane, and appropriate conditions must be established to maintain its native structure and function.

How do the conformational dynamics of lspA influence its substrate binding and catalytic mechanism?

The conformational dynamics of lspA occur on the nanosecond timescale and are crucial for its function. Research using molecular dynamics (MD) simulations and electron paramagnetic resonance (EPR) has revealed that lspA samples multiple conformational states that impact substrate binding and catalysis .

The enzyme exhibits three primary conformational states:

• Closed conformation: Most prevalent in the apo state, where the periplasmic helix (PH) occludes the charged active site from the lipid bilayer, protecting the polar catalytic residues from the hydrophobic membrane environment.

• Intermediate conformation: Stabilized by antibiotic binding (e.g., globomycin), representing a partially accessible active site.

• Open conformation: Required for substrate binding, creating a trigonal cavity where the lipoprotein substrate can sterically fit into the active site.

These conformational states exist in an equilibrium that shifts based on substrate or inhibitor binding. The β-cradle and periplasmic helix act as a "clamp" that can adjust their relative positions to accommodate different substrates. In the most closed conformation, these elements are only 6.2 Å apart, completely blocking access to the active site .

This structural plasticity explains how lspA can process various lipoprotein substrates with different sequences while maintaining specificity for the correct cleavage site.

What experimental approaches can effectively study the nanosecond timescale conformational changes in lspA?

Studying the rapid conformational changes of lspA requires a hybrid experimental approach combining multiple techniques:

A particularly effective methodology involves introducing cysteine residues at strategic positions for spin labeling, followed by EPR spectroscopy. This approach has been successfully employed to detect the movement of the periplasmic helix in lspA . The CW EPR spectra can reveal the presence of multiple conformational states through their characteristic line shapes, while DEER EPR provides distance distributions between labeled sites.

The combination of these experimental techniques with MD simulations allows researchers to visualize conformational states that may not be captured by any single method. For instance, the most open conformation of lspA was observed in MD simulations but was present at too low a population to be detected in experimental EPR data .

How does the binding of antibiotics like globomycin affect the structural dynamics and function of lspA?

Antibiotic binding to lspA induces significant changes in its conformational dynamics that directly relate to the inhibition mechanism. Studies comparing apo lspA to globomycin-bound lspA have revealed:

• Globomycin stabilizes an intermediate conformation of the periplasmic helix that differs from both the predominant closed state of apo lspA and the open state required for substrate binding .

• Multiple binding modes exist for globomycin, as evidenced by the presence of multiple distance populations in DEER EPR experiments with globomycin-bound lspA .

• The inhibition mechanism involves both:

  • Direct competition with substrate binding

  • Stabilization of non-productive conformational states that prevent proper substrate positioning and catalysis

This is illustrated by the observation that in globomycin-bound structures, the periplasmic helix adopts conformations that would sterically hinder prolipoprotein binding in the orientation required for catalysis. The antibiotic essentially locks the enzyme in conformations that are incompatible with its normal catalytic cycle.

Understanding these dynamics provides valuable insights for the design of new antibiotics targeting lspA, as compounds that can effectively stabilize non-productive conformations may serve as potent inhibitors with reduced likelihood of resistance development.

What role does the periplasmic helix play in lspA function and how can its movement be experimentally tracked?

The periplasmic helix (PH) of lspA plays a critical role in:

• Regulating access to the active site through its conformational dynamics

• Protecting the polar catalytic residues from the hydrophobic membrane environment

• Forming part of the "clamp" that positions substrates for proper cleavage

• Determining the specificity of substrate binding

The movement of the PH can be experimentally tracked using several complementary approaches:

• Site-directed spin labeling (SDSL) combined with EPR spectroscopy:

  • Strategic introduction of cysteine residues at positions along the PH

  • Labeling with nitroxide spin labels

  • CW EPR to measure mobility parameters

  • DEER EPR to measure distance distributions between labeled sites

• FRET-based approaches:

  • Introduction of fluorescent donor and acceptor pairs

  • Measurement of energy transfer efficiency as a function of conformational changes

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Determination of solvent accessibility changes in different functional states

  • Identification of regions undergoing conformational changes

These experimental approaches have revealed that the PH fluctuates on the nanosecond timescale and samples distinct conformations in different functional states of the enzyme . The conformational equilibrium of the PH is shifted by substrate binding or antibiotic inhibition, making it a key element in understanding both the catalytic mechanism of lspA and the design of potential inhibitors.

What are the distinctive features of Shewanella loihica lspA compared to lspA from other bacterial species?

Shewanella loihica lspA shares the core structural and functional features of the peptidase A8 family while exhibiting species-specific characteristics. Comparative analysis reveals:

The amino acid sequence of Shewanella loihica lspA (MPSSWKESGLRWYWVVVLVFVADQLSKQWVLANFDLRESINLLPFFNFTYVRNYGAAFSFLNDAGGWQRWLFTLVAVGFSTLLTVWLRKQPKGLWRLNLAYTLVIGGALGNLIDRLQHGFVVDFLDFYWKTSHFPAFNIADSAICVGAGLIILDSFISERKPNGEDVAKG) shows high conservation in the active site residues while displaying more variation in other regions .

The significance of Shewanella loihica lspA extends beyond basic research, as Shewanella species are emerging pathogens associated with severe community- and hospital-acquired infections . Understanding the structure and function of lspA in these organisms could potentially contribute to developing targeted antimicrobial strategies.

Why is lspA considered a promising target for antibiotic development?

LspA represents an excellent target for antibiotic development for several key reasons:

• Essential role: LspA is essential for the viability of Gram-negative bacteria, making it an indispensable target .

• Virulence factor: In Gram-positive bacteria, while not essential for viability, lspA contributes significantly to virulence .

• Resistance barrier: The highly conserved nature of the active site means that mutations that would impede antibiotic binding would likely also interfere with the enzyme's natural substrate binding and catalytic function, presenting a high barrier to resistance development .

• Structural insights: The detailed understanding of lspA's conformational dynamics provides a foundation for structure-based drug design approaches .

• Existing proof of concept: Antibiotics like globomycin and myxovirescin have demonstrated the effectiveness of targeting lspA, though they are not commercially viable as therapeutic agents .

The combination of these factors makes lspA a compelling target for researchers developing new strategies to combat antibiotic resistance, particularly for Gram-negative pathogens where new treatment options are urgently needed.

How can recombinant lspA be utilized to screen for potential antibiotic compounds?

Recombinant lspA proteins can serve as valuable tools for high-throughput screening of potential antibiotic compounds through several methodological approaches:

• Enzymatic activity-based screening:

  • Development of fluorogenic or chromogenic substrates that generate detectable signals upon cleavage

  • Screening compounds for their ability to inhibit this enzymatic activity

  • Quantification of IC₅₀ values for promising hits

• Biophysical interaction screening:

  • Surface plasmon resonance (SPR) to detect direct binding of compounds to recombinant lspA

  • Thermal shift assays to identify compounds that stabilize specific conformations

  • Microscale thermophoresis to measure binding affinities

• Structural biology approaches:

  • Co-crystallization of recombinant lspA with potential inhibitors

  • NMR-based fragment screening to identify binding sites

  • Computational docking validated by experimental binding studies

• Conformational dynamics screening:

  • EPR-based assays to identify compounds that alter the conformational equilibrium of lspA

  • Targeting the stabilization of non-productive conformations similar to globomycin's mechanism

These screening approaches can be integrated into a comprehensive drug discovery pipeline, starting with high-throughput methods and progressing to more detailed mechanistic studies for promising candidates.

What are the critical factors for maintaining structural integrity and activity of recombinant lspA during purification?

Maintaining the structural integrity and activity of recombinant lspA during purification requires careful attention to several critical factors:

• Detergent selection: The choice of detergent is crucial for membrane protein purification. Commonly used detergents include:

  • n-Dodecyl β-D-maltoside (DDM)

  • Fos-choline-12 (FC12)

  • Lauryl maltose neopentyl glycol (LMNG)

  The impact of detergent choice is significant, as demonstrated in studies where even small amounts of solvents like DMSO can dramatically affect protein conformation .

• Buffer composition: Buffer systems should maintain:

  • Appropriate pH (typically 7.0-8.0)

  • Ionic strength to prevent aggregation

  • Stabilizing additives (e.g., glycerol)

• Temperature control: Purification should be conducted at 4°C when possible to minimize protein degradation.

• Rapid processing: Minimizing the time between cell lysis and final purification steps helps preserve activity.

• Oxidation prevention: Addition of reducing agents (e.g., DTT, β-mercaptoethanol) can prevent oxidation of critical cysteine residues.

• Protease inhibitors: Inclusion of protease inhibitor cocktails prevents degradation during purification.

• Quality control: Regular assessment of protein purity, homogeneity, and activity throughout the purification process.

These considerations are essential for obtaining functionally active recombinant lspA that can be reliably used in subsequent experimental applications.

How can molecular dynamics simulations be effectively integrated with experimental data to understand lspA function?

The integration of molecular dynamics (MD) simulations with experimental data provides a powerful approach to understanding lspA function. An effective integration methodology includes:

• Iterative refinement cycles:

  • Initial MD simulations based on crystal structures

  • Experimental validation of simulation predictions (e.g., using EPR)

  • Refinement of simulation parameters based on experimental results

  • Generation of new testable hypotheses from refined simulations

• Multi-scale modeling approaches:

  • Atomistic simulations for detailed active site interactions

  • Coarse-grained simulations for longer timescale conformational changes

  • Inclusion of membrane environment effects

• Experimental constraints implementation:

  • Incorporation of distance measurements from EPR as restraints in simulations

  • Use of chemical crosslinking data to validate conformational states

  • Hydrogen-deuterium exchange data to inform about solvent accessibility

• Ensemble analysis:

  • Comparison of conformational ensembles from simulations with experimental distributions

  • Statistical validation of sampled conformations

This hybrid approach has been successfully employed to identify conformational states of lspA not observed in crystal structures, such as the closed state that occludes the active site from the membrane and the open state that allows substrate binding . The combination of computational and experimental methods provides a more complete picture of the enzyme's dynamic behavior than either approach alone.

What emerging technologies might advance our understanding of lspA structure-function relationships?

Several emerging technologies hold promise for advancing our understanding of lspA structure-function relationships:

• Cryo-electron microscopy (cryo-EM):

  • Potential to capture lspA in multiple conformational states

  • Visualization of lspA-substrate complexes without crystallization constraints

  • Time-resolved studies of the catalytic cycle

• Single-molecule FRET:

  • Real-time monitoring of individual lspA molecules' conformational changes

  • Correlation of dynamics with catalytic events

  • Detection of rare or transient conformational states

• Advanced computational methods:

  • Machine learning-augmented molecular dynamics

  • Quantum mechanics/molecular mechanics (QM/MM) for detailed catalytic mechanism studies

  • Enhanced sampling techniques for accessing longer timescales

• In-cell structural biology:

  • NMR and EPR techniques adapted for in-cell measurements

  • Visualization of lspA dynamics in its native environment

  • Understanding of how cellular factors influence lspA function

• Integrative structural biology:

  • Combining multiple experimental techniques with computational methods

  • Development of unified models that explain all available data

  • Enhanced predictive power for drug design applications

These technological advances may reveal new aspects of lspA function and provide opportunities for more targeted antibiotic development strategies.

How might genetic diversity in lspA across Shewanella species impact antibiotic development strategies?

The genetic diversity of lspA across Shewanella species has important implications for antibiotic development:

• Conservation analysis: Comparing lspA sequences from different Shewanella species (e.g., S. loihica vs. S. oneidensis) reveals regions of high conservation that may represent ideal targets for broad-spectrum antibiotics .

• Species-specific features: Identifying unique structural or functional features of lspA in pathogenic Shewanella species could enable development of targeted antibiotics with reduced impact on beneficial bacteria.

• Evolution of resistance: Understanding natural sequence variations in lspA can help predict potential resistance mutations and inform strategies to design antibiotics with higher barriers to resistance.

• Comparative inhibition studies: Testing candidate inhibitors against lspA from multiple Shewanella species can help identify compounds with consistent effectiveness across the genus.

• Clinical relevance: As Shewanella species emerge as human pathogens , understanding the functional consequences of lspA diversity becomes increasingly important for developing effective treatments.

The clinical significance of this research is underscored by reports of Shewanella infections in humans, particularly in patients with underlying conditions such as hepatobiliary diseases, malignancy, chronic kidney disease, and diabetes mellitus .