Recombinant Shewanella loihica Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiB; Shew_3375; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-549
Protein Length
full length protein
Species
Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Target Names
ubiB
Target Protein Sequence
MTIKSMRRAYQVVKTVLQYGLDDLIPAKLKPWYFRLLRWSFFWLTNQHKDKVGGERLKLA MQELGPVYIKFGQMLSTRRDLLSDEWAEELAMLQDRVPPFDSAIARAQIEAELGAPIETY FDNFDDTPLASASISQVHTATLKSNGEEVVLKVLRPNVEEKVHADLLLMTQSAQVLETLL GHGNRLRPAEVVEDYRTTIEGELNLKLEALNAIKLRNNFIDSGALYIPKMYEEFCFTRLI VMERIYGVPVSDRAALEAQGTNLKLLAERGVELFFTQVFRDNFFHADMHPGNIFVSTEHP EDPFYIGLDCGIMGTLTEQDKRYLAENFLAFFNRDYTRIAQLYIESGWVAADTDLVAFEQ AIKVVCEPMFNKPLDEISFGHVLLELFRTARRFDMVVQPQLVLLEKTLLYIEGLGRQLYP QLDLWQTAKPFLESWMAEQMGPLGMAKKIKKQFPYWTDKLPELPELVYDNLKMGKNFVNS QNQLLDRYLKQQQKAHKSNYLLITSAVLVICGSILFSQNATLWASYACIGIGATLWLLGW RSRPKNRKF
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which is involved in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UbiB and what is its role in ubiquinone biosynthesis?

UbiB is classified as a probable ubiquinone biosynthesis protein in Shewanella loihica. It belongs to the UbiB family of proteins that are involved in the biosynthesis of ubiquinone (Coenzyme Q), a redox-active lipid essential for oxidative phosphorylation in cellular respiration . The exact biochemical function of UbiB in the pathway remains under investigation, but research suggests that UbiB proteins, like their yeast homolog Coq8, are required for coenzyme Q biosynthesis and likely function in the conversion process of aromatic precursors to the ubiquinone head group . Coenzyme Q is particularly essential for the mitochondrial respiratory chain function, serving as an electron carrier that enables efficient energy production .

What are the structural characteristics of the recombinant UbiB protein?

The recombinant UbiB protein from Shewanella loihica is available as a partial protein with UniProt accession number A3QIE3 . The protein has a purity of >85% as determined by SDS-PAGE analysis and is produced in mammalian cells, which may provide certain post-translational modifications different from bacterial expression systems . While specific structural elements such as binding domains are not fully characterized in the search results, understanding the protein's structure is critical for functional studies. Computational approaches similar to those used for related enzymes like Coq6 could be applied to predict structural features, including potential substrate access channels and binding sites .

How does Shewanella loihica's ubiquinone system compare to other species?

Shewanella loihica produces ubiquinones consisting mainly of Q-7 and Q-8, along with menaquinone MK-7 . This ubiquinone profile may differ from other bacterial species, reflecting adaptations to its unique ecological niche. The presence of both ubiquinones and menaquinones suggests versatility in electron transport chains, potentially contributing to the organism's ability to thrive in varied environments. While the UbiB protein is part of a conserved family found across different species (including homologs like Coq8 in yeast), the specific variants and their functional implications may vary between organisms . Understanding these differences requires comparative genomic and biochemical approaches to elucidate species-specific adaptations in ubiquinone biosynthesis pathways.

What are the optimal storage conditions for recombinant UbiB protein?

For optimal preservation of recombinant UbiB protein activity, specific storage conditions should be followed:

FormulationRecommended StorageShelf Life
Liquid form-20°C/-80°C6 months
Lyophilized form-20°C/-80°C12 months
Working aliquots4°CUp to one week

Repeated freezing and thawing cycles should be avoided as they can significantly decrease protein stability and activity . The shelf life is influenced by multiple factors including buffer composition, storage temperature, and the inherent stability of the protein itself . For long-term storage, preparing single-use aliquots containing glycerol as a cryoprotectant is recommended to maintain protein integrity.

How should lyophilized UbiB protein be reconstituted for experimental use?

The recommended reconstitution protocol for lyophilized UbiB protein involves several critical steps:

  • Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation)

  • Prepare aliquots for long-term storage at -20°C/-80°C

This reconstitution method helps maintain protein stability and prevents degradation during storage . The addition of glycerol serves as a cryoprotectant, reducing protein denaturation during freeze-thaw cycles and prolonging the functional lifespan of the protein. For specialized applications requiring alternative buffer systems, pilot experiments should be conducted to verify protein stability and activity in the new formulation.

What experimental approaches can be used to study UbiB function in vitro?

Several complementary experimental approaches can be employed to characterize UbiB function:

  • Enzymatic assays: Developing activity assays based on potential substrates involved in ubiquinone biosynthesis

  • Structural studies: Utilizing techniques such as homology modeling, molecular dynamics simulations, and substrate docking calculations as demonstrated with related enzymes like Coq6

  • Chemical genetics: Employing specific inhibitors to probe protein function, similar to the COQ8 inhibitor TTP-UNC-CA157 that targets human COQ8 proteins

  • Protein-protein interaction studies: Using co-immunoprecipitation, yeast two-hybrid screens, or crosslinking coupled with mass spectrometry to identify interaction partners

  • Mutagenesis: Creating targeted mutations to investigate key residues involved in substrate binding or catalysis

The development of specific chemical tools to probe UbiB function would significantly advance understanding, as the lack of potent, selective inhibitors has hampered full characterization of UbiB proteins .

Why is Shewanella loihica valuable for studying ubiquinone biosynthesis?

Shewanella loihica offers several advantages as a model organism for studying ubiquinone biosynthesis:

  • Natural ubiquinone production: It naturally synthesizes ubiquinones (primarily Q-7 and Q-8) and menaquinone MK-7, providing a native system for studying these pathways

  • Genomic characteristics: Its relatively compact genome of approximately 4.5 Mbp with 3,859 protein genes and 124 RNA genes facilitates genetic manipulation and analysis

  • Metabolic versatility: Being facultatively anaerobic, it allows for studies under both aerobic and anaerobic conditions, providing insights into respiratory chain adaptations

  • Environmental adaptation: Its psychrotolerant nature (growth at 0-42°C) permits investigation of temperature-dependent variations in membrane composition and respiratory components

  • Ecological relevance: Originally isolated from iron-rich microbial mats at a hydrothermal vent, it represents adaptations to extreme environments, potentially including specialized ubiquinone systems

These characteristics make Shewanella loihica an excellent model for understanding fundamental aspects of ubiquinone biosynthesis and its role in environmental adaptation.

What are the optimal growth conditions for Shewanella loihica to study UbiB expression?

While the search results don't provide specific optimized protocols for UbiB expression in Shewanella loihica, general growth conditions for the organism have been established. Shewanella loihica is psychrotolerant, capable of growing at temperatures ranging from 0-42°C, and is facultatively anaerobic . Growth on Luria–Bertani agar plates has been demonstrated, and the organism appears as orange, rod-shaped bacteria with dimensions of approximately 1.8 µm in length and 0.7 µm in width .

For studying UbiB expression specifically, researchers should consider:

  • Varying oxygen availability to examine effects on respiratory chain components

  • Testing different temperature conditions within the organism's growth range

  • Examining expression under different nutrient limitations or carbon sources

  • Monitoring growth phases to identify optimal UbiB expression timing

A methodical approach involving RT-PCR, western blotting, or reporter gene constructs could be employed to determine conditions that maximize UbiB expression for subsequent protein purification and functional studies.

How can genomic approaches enhance our understanding of UbiB in Shewanella loihica?

Genomic approaches provide powerful tools for investigating UbiB in the context of Shewanella loihica's broader metabolic networks:

  • Comparative genomics: Analyzing UbiB conservation across the 49 Shewanella species with 248 available genomes could reveal species-specific adaptations in ubiquinone biosynthesis

  • Transcriptomic analysis: RNA-seq under different environmental conditions could identify co-regulated genes and regulatory networks involving UbiB

  • Proteogenomics approach: Integrating proteomic data with genomic information can improve annotation and identify potential post-translational modifications or alternative protein forms7

  • Targeted gene disruption: CRISPR-Cas9 or traditional homologous recombination approaches to create UbiB mutants and assess phenotypic consequences

  • Metabolomic profiling: Analyzing changes in ubiquinone and intermediate metabolites in wild-type versus UbiB-modified strains

The genomic data available for Shewanella loihica (4,602,594 nucleotides, 3,859 protein genes, and 124 RNA genes) provides a solid foundation for these approaches . Additionally, the relatively high GC content (53.7%) should be considered when designing primers or expression constructs .

How does UbiB interact with the coenzyme Q biosynthetic pathway in bacteria?

Understanding UbiB's interactions with the coenzyme Q biosynthetic pathway requires a multi-faceted experimental approach:

  • Metabolic profiling: Using LC-MS to identify and quantify CoQ precursors and intermediates in wild-type versus UbiB-deficient strains, similar to the approach used to study the yeast CoQ pathway

  • Protein complex isolation: Employing affinity purification coupled with mass spectrometry to identify proteins that physically interact with UbiB

  • Synthetic genetic interactions: Screening for genetic interactions between UbiB and other genes in the CoQ pathway to identify functional relationships

  • Enzymatic assays: Developing in vitro assays to test potential substrates and biochemical activities

In yeast, the CoQ biosynthetic pathway involves conversion of tyrosine to 4-hydroxybenzoate (4-HB) through intermediates like 4-hydroxyphenylpyruvate (4-HPP) and 4-hydroxybenzaldehyde (4-HBz) . If bacterial pathways share similarities, UbiB might be involved in analogous steps, potentially working with other enzymes in a multiprotein complex similar to those observed in yeast CoQ biosynthesis .

What computational approaches can predict UbiB function and guide experimental design?

Computational approaches provide valuable insights for guiding experimental studies of UbiB:

  • Homology modeling: Creating structural models based on related proteins with known structures

  • Molecular dynamics simulations: Analyzing protein dynamics and potential conformational changes

  • Substrate docking calculations: Predicting interactions with potential substrates and inhibitors

These approaches have been successfully applied to Coq6, another enzyme in the ubiquinone biosynthesis pathway . For Coq6, researchers constructed homology models of the enzyme-FAD complex, conducted molecular dynamics simulations, and performed substrate docking calculations with 3-hexaprenyl-4-hydroxyphenol (4-HP6) . This led to the identification of a putative substrate access channel and the design of mutations that could partially (G248R and L382E single mutations) or completely (G248R-L382E double-mutation) block substrate access .

A similar approach for UbiB could generate testable hypotheses about:

  • Potential cofactor requirements

  • Substrate binding sites

  • Critical residues for catalytic activity

  • Effects of mutations observed in natural variants

How can researchers overcome challenges in studying UbiB enzymatic activity?

Studying UbiB enzymatic activity presents several challenges, including:

  • Substrate identification: The exact substrate of UbiB remains uncertain

  • Protein stability: Maintaining active protein during purification and assays

  • Complex formation: UbiB may function within multi-protein complexes

  • Membrane association: As part of ubiquinone biosynthesis, UbiB may interact with membrane components

To address these challenges, researchers can employ:

  • Substrate screening: Testing multiple potential substrates using analytical techniques like LC-MS

  • Optimized buffer conditions: Systematic testing of buffer components, pH, salt concentration, and additives to maintain protein stability

  • Detergent screening: Identifying appropriate detergents for solubilizing membrane-associated complexes

  • Co-expression strategies: Expressing UbiB with potential partner proteins to stabilize complex formation

  • Chemical genetics: Using specific inhibitors like those developed for COQ8 to probe function

The development of the COQ8 inhibitor TTP-UNC-CA157 demonstrates the potential of chemical tools to advance understanding of these challenging proteins . Similar approaches could be applied to UbiB to facilitate functional characterization.

How does bacterial UbiB compare to eukaryotic homologs like COQ8?

Comparing bacterial UbiB with eukaryotic homologs reveals important insights into evolutionary conservation and functional divergence:

While bacterial UbiB and eukaryotic COQ8 appear to serve similar roles in ubiquinone biosynthesis, there are likely structural and functional differences reflecting their distinct cellular contexts. In eukaryotes, COQ8 proteins (COQ8A and COQ8B in humans) are known to be involved in coenzyme Q biosynthesis, and inhibitors targeting them affect this process in cells . The development of the inhibitor TTP-UNC-CA157 specifically for human COQ8 proteins has facilitated understanding their roles .

Key comparative aspects to investigate include:

  • Subcellular localization (mitochondrial for eukaryotic homologs)

  • Interaction partners within their respective biosynthetic complexes

  • Substrate specificity and regulatory mechanisms

  • Cofactor requirements and catalytic mechanisms

A systematic comparison using sequence analysis, structural modeling, and biochemical characterization would provide insights into both conserved features essential for function and species-specific adaptations.

What is the distribution of UbiB variants across Shewanella species?

The distribution of UbiB variants across Shewanella species could provide insights into evolutionary adaptation and functional specialization. While the search results don't specifically address UbiB distribution, they do provide a relevant parallel in the qnrA gene:

The qnrA gene, which codes for a pentapeptide repeat protein that affects quinolone and fluoroquinolone susceptibility, shows significant diversity across Shewanella species . It was detected in 22.9% of 248 genomes spanning 49 Shewanella species, with multiple variants identified including previously known variants (QnrA1, QnrA2, QnrA3, QnrA4, QnrA7, QnrA10) and 11 novel variants with 3-7 amino acid substitutions .

A similar analysis of UbiB distribution could examine:

  • Presence/absence patterns across Shewanella species

  • Sequence variations and their correlation with ecological niches

  • Selection pressures acting on different protein regions

  • Horizontal gene transfer events that might have shaped UbiB evolution

This type of analysis would contribute to understanding both the core functions of UbiB and its potential role in environmental adaptation.

How might UbiB function contribute to Shewanella's environmental adaptations?

UbiB's role in ubiquinone biosynthesis likely contributes significantly to Shewanella's remarkable environmental adaptations:

Shewanella loihica was isolated from iron-rich microbial mats at a hydrothermal vent and demonstrates psychrotolerance (growth at 0-42°C) . These adaptations to extreme environments likely involve specialized membrane compositions and respiratory chain components. Ubiquinones, which UbiB helps synthesize, are key components of respiratory electron transport chains that enable energy generation under various conditions.

Specific adaptations might include:

  • Temperature adaptation: Different ubiquinone variants may have properties optimized for function across temperature ranges

  • Respiratory versatility: The ability to use various electron acceptors (although S. loihica specifically showed no growth with nitrate, nitrite, DMSO or thiosulfate as electron acceptors with lactate as the electron donor)

  • Metal reduction capabilities: Shewanella species have demonstrated abilities to reduce metals like uranium and chromium, potentially involving respiratory chain components

Understanding UbiB's specific contribution to these adaptations would require comparative studies across growth conditions and between species with different environmental niches.

What are the implications of UbiB research for bioremediation applications?

Research on UbiB has significant implications for bioremediation applications using Shewanella species:

Shewanella species have demonstrated remarkable capabilities for environmental remediation, particularly for heavy metals. They can "lessen the mobility of uranium (U) in groundwater" through transformation of U(VI) to insoluble U(IV), and assist in chromium cleanup through formation of solid oxides during Cr(VI) reduction to Cr(III) . Some species also contribute to arsenic detoxification through methylation processes .

Understanding UbiB's role in ubiquinone biosynthesis could contribute to these applications by:

  • Optimizing respiratory function: Enhancing electron transport efficiency for metal reduction processes

  • Improving stress resistance: Increasing tolerance to environmental stressors during bioremediation

  • Engineering enhanced strains: Creating modified Shewanella with optimized ubiquinone systems for specific remediation tasks

The connection between respiratory chain components (including ubiquinone) and metal reduction capabilities makes UbiB research potentially valuable for developing improved bioremediation strategies.

How might inhibitors of UbiB be developed and utilized in research?

The development of specific UbiB inhibitors would significantly advance research in this field:

The recent development of the first potent COQ8 inhibitor (TTP-UNC-CA157) targeting human COQ8 proteins demonstrates a successful approach that could be adapted for bacterial UbiB . This inhibitor was identified through searching published kinase screening data, followed by screening and optimization of lead candidates .

A similar approach for UbiB could involve:

  • Virtual screening: Using computational models to identify potential inhibitor scaffolds

  • Structure-activity relationship studies: Systematically modifying promising leads to improve potency and selectivity

  • Co-crystal structure determination: As accomplished with COQ8A and UNC-CA157, obtaining structural data to guide inhibitor optimization

  • Mitochondrial targeting: If appropriate, adding groups like triphenylphosphonium to target inhibitors to specific cellular compartments

Such inhibitors would serve as valuable research tools to probe UbiB function, potentially clarifying its precise role in ubiquinone biosynthesis and enabling temporal control over its activity in experimental systems.

What experimental design considerations are critical for studying UbiB in different contexts?

When designing experiments to study UbiB across different research contexts, several critical considerations should be addressed:

  • Protein stability and storage:

    • Use appropriate storage conditions (lyophilized: -20°C/-80°C for up to 12 months; liquid: -20°C/-80°C for up to 6 months)

    • Avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for no more than one week

  • Expression systems:

    • Consider using mammalian cell expression systems as used for the commercial recombinant protein

    • Evaluate bacterial expression systems for higher yield but potentially different post-translational modifications

    • Explore co-expression with partner proteins if complex formation is suspected

  • Experimental controls:

    • Include appropriate negative controls (inactive mutants, unrelated proteins)

    • Use positive controls with known activity when possible

    • Implement internal standards for quantitative measurements

  • Data analysis approaches:

    • Apply proper statistical methods for experimental validation

    • Consider proteogenomic approaches that integrate multiple data types7

    • Implement appropriate false discovery rate controls for protein identification7

  • Environment-specific considerations:

    • Account for temperature effects (S. loihica is psychrotolerant, growing at 0-42°C)

    • Consider oxygen availability (S. loihica is facultatively anaerobic)

    • Assess potential interactions with metal ions or other environmental factors relevant to the organism's natural habitat

Careful attention to these experimental design elements will enhance the reliability and reproducibility of UbiB research across diverse scientific contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.