Recombinant Shewanella loihica Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
htpX; Shew_1723; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Target Names
htpX
Target Protein Sequence
MKRIFLLIATNMAILLVASIVMSILGVNTSTMGGLLVFAAIFGFGGAFISLAISKWMAKK TMGCEVITTPRDNMERWLVDTVARQAEQAGIKMPEVAIYQSPELNAFATGPSKDNSLVAV SSGLLYGMTQDEIEGVLAHEVSHVANGDMVTLTLIQGVVNTFVIFAARVVASIIDNFVAS NDEEGEGLGMFAYMAVVFVLDMLFGILASMIVAYFSRVREFKADAGGAQLAGKHKMIAAL DRLRQGPETGAMPAQMAAFGINGKKSMAELMMSHPPLEKRIEALRAQ
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella loihica Protease HtpX and what is its biological function?

Shewanella loihica Protease HtpX is a membrane-bound zinc metalloprotease that functions primarily in proteolytic quality control of membrane proteins. It belongs to a class of proteases that help maintain membrane protein homeostasis by facilitating the degradation of misfolded or damaged membrane proteins . HtpX is structurally classified as a zinc-dependent endoprotease, which requires zinc as a cofactor for its proteolytic activity. In bacterial systems such as Escherichia coli, HtpX works in conjunction with FtsH, another membrane-bound protease that is ATP-dependent, forming part of a comprehensive membrane protein quality control system . The coordinated activity of these proteases is essential for maintaining cellular integrity, particularly under stress conditions that might lead to protein misfolding or damage.

Where was Shewanella loihica PV-4 originally isolated from and what are its ecological characteristics?

Shewanella loihica strain PV-4 was isolated from an iron-rich microbial mat located near a deep-sea hydrothermal vent on the Loihi Seamount in Hawaii . This environment is characterized by unique geochemical conditions including high pressure, variable temperatures, and rich mineral content, particularly iron. Members of the Shewanella genus, including S. loihica PV-4, are known for their respiratory versatility and ability to thrive in redox-stratified environments . They can utilize a wide variety of terminal electron acceptors, which contributes to their ecological success in environments with fluctuating oxygen levels. The adaptation to these specific ecological niches has likely shaped the genome and protein expression patterns of S. loihica, including the evolution of proteins like HtpX that help maintain cellular function under these challenging conditions .

How should Recombinant Shewanella loihica Protease HtpX be stored and handled for optimal stability?

Recombinant Shewanella loihica Protease HtpX should be stored under specific conditions to maintain its stability and enzymatic activity. According to product information, the protein is typically stored in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein . For short-term storage, the protein can be kept at 4°C for up to one week, but for extended storage, it should be maintained at -20°C or -80°C .

It's important to note that repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and loss of activity. Instead, it is recommended to prepare working aliquots that can be stored at 4°C for immediate use, while keeping the main stock frozen . When handling the protein, care should be taken to maintain appropriate temperature conditions and avoid contamination. Additionally, since HtpX is a zinc-dependent protease, the presence of zinc ions in the buffer may be necessary for maintaining its activity during experiments .

What are the methods for expressing and purifying recombinant Shewanella loihica Protease HtpX?

The expression and purification of Recombinant Shewanella loihica Protease HtpX involves several key steps. Based on described methodologies for similar proteases, the process typically begins with PCR amplification of the htpX gene from genomic DNA using specifically designed primers that incorporate appropriate restriction sites .

For expression, the amplified htpX gene can be cloned into expression vectors such as pHT43, as demonstrated for other recombinant proteases. The resulting construct is transformed into suitable host organisms like Escherichia coli BL21(DE3) for initial validation and then into more specialized hosts like Bacillus subtilis WB800N for optimized expression . The transformation typically involves:

  • Digestion of the PCR product and vector with appropriate restriction enzymes (e.g., BamHI and SmaI)

  • Ligation of the digested fragments using T4 ligase

  • Transformation into the host strain

  • Selection of positive transformants using appropriate antibiotics

For protein expression, the recombinant strain is cultured in suitable media (e.g., LB with appropriate antibiotics) until reaching optimal cell density (OD600 ≈ 0.6–0.8), followed by induction using IPTG at a final concentration of approximately 1 mM .

For purification of HtpX, special considerations must be taken due to its membrane-bound nature and tendency for self-degradation upon cell disruption or membrane solubilization. Based on methods used for similar proteases like E. coli HtpX, purification might require denaturing conditions followed by refolding in the presence of a zinc chelator . The purified protein can then be analyzed using SDS-PAGE and enzymatic activity assays to confirm its identity and functionality.

What approaches can be used to measure the proteolytic activity of HtpX in vitro?

Measuring the proteolytic activity of HtpX in vitro requires specialized approaches due to its nature as a membrane-bound zinc-dependent protease. Several methodological approaches can be employed:

  • Self-cleavage assay: One approach is to monitor the self-degradation activity of purified HtpX. This involves incubating the purified protease with zinc and observing self-cleavage patterns using SDS-PAGE analysis . The appearance of lower molecular weight bands indicates proteolytic activity.

  • Soluble substrate degradation: HtpX can be tested against standard protease substrates such as casein. In this approach, the purified enzyme is incubated with the substrate in the presence of zinc, and degradation is monitored through various methods including SDS-PAGE or spectrophotometric techniques .

  • Membrane protein substrate cleavage: For more physiologically relevant assays, HtpX activity can be tested against solubilized membrane proteins such as SecY. This involves incubating the enzyme with the purified substrate and analyzing the degradation products using SDS-PAGE and western blotting techniques .

  • In vivo proteolysis assays: These assays involve overexpressing both HtpX and a target substrate protein in host cells and monitoring the degradation of the substrate. This approach provides insights into the physiological activity of HtpX within cellular contexts .

For all these assays, it's critical to include appropriate controls (samples without zinc or with protease inhibitors) to confirm that the observed proteolytic activity is specifically due to HtpX. Additionally, optimizing reaction conditions (pH, temperature, zinc concentration) is essential for obtaining reliable and reproducible results.

How does Shewanella loihica Protease HtpX compare functionally with homologs in other bacterial species?

Shewanella loihica Protease HtpX shares functional similarities with homologs found in other bacterial species, particularly Escherichia coli HtpX, but also exhibits species-specific differences that reflect evolutionary adaptations to different ecological niches.

In E. coli, HtpX functions as part of a membrane protein quality control system in conjunction with FtsH, an ATP-dependent protease . Similar to S. loihica HtpX, the E. coli homolog is a membrane-bound zinc metalloprotease that degrades misfolded or damaged membrane proteins. Experimental evidence has confirmed its proteolytic activities against both membrane and soluble proteins, including self-cleavage activity and degradation of substrates like casein and SecY .

In Bacillus subtilis, the HtpX homolog (encoded by the ykrL gene) is part of a different regulatory network. Unlike E. coli, where htpX is regulated by the CpxR/CpxA extracytoplasmic stress response system, the B. subtilis ykrL gene is repressed by Rok and by a novel type of DNA binding protein called YkrK . This different regulatory mechanism suggests adaptation to the specific physiological needs of Gram-positive bacteria.

The functional importance of HtpX varies across species. In E. coli, disruption of both htpX and ftsH in a strain with the ftsH suppressor mutation sfhC21 results in thermosensitivity, while single disruptions have minimal effects . This suggests functional redundancy in some bacterial species, but the degree of this redundancy may vary in S. loihica depending on its specific membrane protein quality control systems.

These comparative differences highlight how HtpX proteases have evolved functionally diverse roles across bacterial species while maintaining their core proteolytic function in membrane protein quality control.

What is the role of HtpX in the context of Shewanella's unique respiratory versatility?

Shewanella species, including S. loihica, are renowned for their exceptional respiratory versatility and ability to utilize a wide variety of terminal electron acceptors . This versatility is primarily dependent on the expression of multiple c-type cytochromes, which typically give Shewanella cultures their characteristic orange or pink coloration . The role of HtpX in this context is likely multifaceted:

  • Membrane protein quality control: As a membrane-bound protease, HtpX likely plays a crucial role in maintaining the integrity and function of the various membrane-bound electron transport components that enable Shewanella's respiratory versatility. By degrading misfolded or damaged membrane proteins, HtpX helps maintain optimal respiratory function under varying environmental conditions.

  • Heme and cytochrome homeostasis: Shewanella species contain complex pathways for heme biosynthesis and c-type cytochrome maturation, which are essential for their respiratory capabilities. Many Shewanella species, including S. loihica PV-4 and S. oneidensis MR-1, harbor two ferrochelatase paralogues (hemH1 and hemH2) for the biosynthesis of c-type cytochromes . HtpX may indirectly influence cytochrome maturation by regulating the turnover of membrane proteins involved in heme transport or cytochrome assembly.

  • Adaptation to environmental stressors: The deep-sea hydrothermal vent habitat of S. loihica PV-4 subjects the organism to various stressors including pressure, temperature fluctuations, and varying redox conditions . As a stress-controlled protease (indicated by its name, Heat shock protein X), HtpX likely helps S. loihica adapt to these environmental challenges by maintaining membrane protein homeostasis under stress conditions.

The presence and function of HtpX in S. loihica thus represents an important component in the complex adaptive machinery that enables this organism to thrive in challenging environments through its remarkable respiratory flexibility.

What genetic regulatory mechanisms control the expression of htpX in Shewanella loihica compared to other bacterial species?

The genetic regulation of htpX varies significantly across bacterial species, reflecting different evolutionary adaptations to environmental stressors and membrane protein quality control requirements. While specific information about htpX regulation in Shewanella loihica is limited in the provided search results, we can draw some comparisons and make informed inferences:

In Escherichia coli, htpX is regulated by the CpxR/CpxA extracytoplasmic stress response system . This two-component system responds to envelope stress and regulates various genes involved in maintaining envelope integrity, including those encoding proteases like HtpX and DegP (HtrA). When envelope stress is detected, CpxA phosphorylates CpxR, which then activates the transcription of htpX and other stress response genes.

In Bacillus subtilis, the htpX homolog (ykrL) is under different regulatory control. It is repressed by Rok and by YkrK, a novel type of DNA binding protein encoded by a gene adjacent to ykrL but divergently transcribed . This regulatory mechanism is distinct from the CpxR/CpxA system in E. coli and suggests adaptation to the specific physiological needs of Gram-positive bacteria.

For Shewanella loihica, the regulatory mechanism may share some similarities with Shewanella oneidensis MR-1, another well-studied Shewanella species. In S. oneidensis MR-1, there is evidence of complex regulatory networks controlling genes involved in heme biosynthesis and cytochrome expression . These networks likely respond to environmental factors such as oxygen availability, iron concentration, and various stressors. Given the importance of membrane protein quality control in maintaining respiratory functions, htpX in S. loihica is likely integrated into these regulatory networks.

Interestingly, the genomic context of htpX may provide clues about its regulation. In some bacteria, htpX is co-transcribed with other genes involved in related functions. For example, in S. oneidensis MR-1, the periplasmic glutathione peroxidase gene pgpD is located in the same operon with hemH2, though this arrangement is absent in S. loihica PV-4 . Such genomic arrangements can indicate co-regulation and functional relationships between genes.

How can recombinant Shewanella loihica Protease HtpX be utilized in structural biology studies?

Recombinant Shewanella loihica Protease HtpX presents several valuable opportunities for structural biology studies that could enhance our understanding of membrane proteases and protein quality control mechanisms:

  • X-ray crystallography and cryo-EM studies: Purified recombinant HtpX can be used for crystallization trials and subsequent X-ray crystallography or cryo-electron microscopy studies. These approaches would provide high-resolution structural information about the protease's active site, zinc-binding domains, and membrane-spanning regions. Special consideration must be given to the membrane-bound nature of HtpX, potentially requiring the use of detergents, nanodiscs, or lipidic cubic phase crystallization methods to maintain the protein in a native-like environment.

  • Structure-function relationship studies: By combining structural data with site-directed mutagenesis, researchers can identify critical residues involved in substrate recognition, catalysis, and zinc coordination. This approach would involve creating specific mutations in the htpX gene, expressing and purifying the mutant proteins, and assessing their activity against model substrates.

  • Protein-substrate interaction studies: Techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) or crosslinking coupled with mass spectrometry can be employed to map the interaction between HtpX and its substrates. These methods could reveal how the protease recognizes misfolded membrane proteins and provide insights into the specificity determinants of this recognition.

  • Comparative structural biology: Comparing the structure of S. loihica HtpX with homologs from other bacterial species, such as E. coli or B. subtilis, could reveal evolutionary adaptations that reflect the different environmental niches and physiological requirements of these organisms. Such comparisons might highlight structural features that contribute to the unique properties of S. loihica HtpX in the context of deep-sea hydrothermal vent environments.

The insights gained from these structural biology approaches would not only advance our fundamental understanding of membrane protein quality control but could also inform the development of novel antimicrobial strategies targeting bacterial proteases.

What potential biotechnological applications exist for Shewanella loihica Protease HtpX?

Shewanella loihica Protease HtpX holds several promising biotechnological applications due to its unique properties as a membrane-bound zinc metalloprotease:

  • Bioremediation tools: Shewanella species are known for their ability to reduce various metals and environmental contaminants. Understanding and potentially engineering HtpX could enhance the stability and stress tolerance of Shewanella strains used in bioremediation applications, particularly in extreme environments similar to the deep-sea hydrothermal vents from which S. loihica was isolated .

  • Protoporphyrin IX (PPIX) production: Research on Shewanella species has shown that disruption of certain heme biosynthesis genes can lead to overproduction of PPIX, an important precursor for various commercial applications including photodynamic therapy agents and fluorescent probes . Although the direct connection between HtpX and PPIX production is not established in the search results, understanding the role of HtpX in membrane protein homeostasis could indirectly contribute to optimizing PPIX production in engineered Shewanella strains.

  • Protein engineering platform: The structural and functional insights gained from studying HtpX could inform the design of engineered proteases with novel specificities or improved stability under extreme conditions. Such engineered enzymes could find applications in industrial processes requiring proteolytic activities under challenging environmental conditions.

  • Microbial fuel cells: Shewanella species are extensively studied for their electron transfer capabilities and potential applications in microbial fuel cells . HtpX, by maintaining membrane protein quality, might indirectly influence the electron transfer efficiency of Shewanella. Understanding and potentially manipulating HtpX function could contribute to enhancing the performance of Shewanella-based bioelectrochemical systems.

  • Biomarker for environmental monitoring: The expression patterns of htpX in response to specific environmental stressors could potentially be utilized as a biomarker for monitoring environmental conditions in aquatic ecosystems, particularly those experiencing metal contamination or other stressors that affect membrane protein integrity.

What are the current challenges and future research directions in studying Shewanella loihica Protease HtpX?

Research on Shewanella loihica Protease HtpX faces several challenges and presents numerous opportunities for future investigations:

  • Membrane protein purification challenges: As a membrane-bound protease, HtpX presents significant technical challenges for purification in its native, active conformation. The protein tends to undergo self-degradation upon cell disruption or membrane solubilization . Developing improved purification protocols that maintain the structural integrity and activity of HtpX remains a significant challenge.

  • Substrate specificity determination: While HtpX is known to be involved in membrane protein quality control, the specific substrates it targets in S. loihica and the determinants of this specificity remain largely unknown. Future research could focus on identifying the physiological substrates of HtpX in S. loihica and characterizing the structural features that mediate substrate recognition.

  • Regulatory network mapping: Understanding how htpX expression is regulated in S. loihica in response to various environmental stressors would provide valuable insights into the adaptive mechanisms of this deep-sea bacterium. This would involve comprehensive transcriptomic and proteomic analyses under different stress conditions, coupled with genetic manipulation to identify regulatory factors.

  • Comparative genomics and evolution: Expanding comparative analyses of htpX across different Shewanella species and correlating genetic variations with environmental adaptations could reveal how this protease has evolved to support the ecological diversification of the genus. The genomic differences already noted between S. loihica PV-4 and S. oneidensis MR-1, such as the absence of certain gene clusters in PV-4 , suggest interesting evolutionary adaptations that merit further investigation.

  • Integration with systems biology approaches: Placing HtpX function in the broader context of S. loihica cellular physiology would require integrating proteomic, metabolomic, and transcriptomic data. Such systems-level analyses could reveal unexpected connections between membrane protein quality control, respiratory versatility, and stress response mechanisms.

  • Development of specific inhibitors: Designing specific inhibitors for HtpX would not only provide valuable research tools but could also have potential applications in controlling Shewanella growth in certain contexts. This would require detailed structural information about the active site and catalytic mechanism of the protease.

How does understanding Shewanella loihica Protease HtpX contribute to broader knowledge in bacterial physiology?

The study of Shewanella loihica Protease HtpX contributes significantly to our broader understanding of bacterial physiology in several important ways:

  • Membrane protein quality control mechanisms: Research on HtpX provides insights into how bacteria maintain membrane protein homeostasis, a critical aspect of cellular physiology that impacts numerous functions including energy generation, nutrient transport, and environmental sensing. By understanding how bacteria manage misfolded or damaged membrane proteins through proteases like HtpX, we gain fundamental knowledge about cellular stress responses and adaptation mechanisms .

  • Ecological adaptations of extremophiles: S. loihica PV-4 was isolated from a deep-sea hydrothermal vent, an environment characterized by extreme conditions . Studying HtpX in this organism helps elucidate how extremophilic bacteria have adapted their protein quality control systems to function under challenging environmental conditions such as high pressure, fluctuating temperatures, and unique geochemical compositions.

  • Respiratory versatility mechanisms: Shewanella species are renowned for their respiratory flexibility, able to utilize diverse electron acceptors including metal oxides . This versatility depends on complex membrane-bound electron transport systems. HtpX likely plays a role in maintaining these systems, and understanding its function contributes to our knowledge of how bacteria achieve and maintain their remarkable metabolic diversity.

  • Evolutionary divergence and speciation: Comparative analyses of HtpX and its regulation across different Shewanella species reveal genetic divergence that likely reflects adaptation to specific ecological niches. For example, differences in gene content and expression between S. loihica PV-4 and S. oneidensis MR-1 provide insights into how bacterial speciation occurs through genomic adaptations to different habitats (iron-rich deep-sea vent versus iron-poor freshwater) .

  • Stress response integration: The regulation of htpX in various bacterial species indicates its integration into broader stress response networks. Understanding these regulatory connections helps map how bacteria coordinate different aspects of their physiology to respond cohesively to environmental challenges.

By advancing our knowledge in these areas, research on S. loihica HtpX contributes to both fundamental biology and potential biotechnological applications, exemplifying how studying specialized bacterial systems can yield broadly applicable insights into cellular function and adaptation.

What standardized protocols should be established for research involving Recombinant Shewanella loihica Protease HtpX?

To advance research on Recombinant Shewanella loihica Protease HtpX, establishing standardized protocols is essential for ensuring reproducibility and facilitating comparative studies across different laboratories. The following standardized protocols should be considered:

  • Gene cloning and expression system standardization:

    • Consensus vector systems optimized for membrane protein expression

    • Standardized codon optimization strategies for heterologous expression

    • Validated induction conditions (inducer concentration, temperature, time)

    • Defined host strains with characterized genetic backgrounds

  • Purification protocol standardization:

    • Optimized membrane solubilization methods that minimize self-degradation

    • Standardized buffer compositions for each purification stage

    • Defined refolding procedures for recovering active enzyme

    • Quality control criteria for assessing purity and integrity

  • Activity assay standardization:

    • Reference substrates with established kinetic parameters

    • Standardized reaction conditions (pH, temperature, zinc concentration)

    • Validated analytical methods for quantifying proteolytic activity

    • Benchmark inhibitors and control reactions

  • Storage and stability guidelines:

    • Defined storage buffer composition (e.g., Tris-based buffer with 50% glycerol)

    • Temperature recommendations for short-term and long-term storage

    • Stability monitoring protocols to detect activity loss over time

    • Guidelines for aliquoting and avoiding freeze-thaw cycles

  • Characterization protocols:

    • Standardized methods for determining zinc binding and dependency

    • Protocols for assessing membrane association and topology

    • Approaches for identifying physiological substrates

    • Procedures for analyzing regulatory responses

Establishing these standardized protocols would facilitate collaboration between research groups, enable meaningful comparison of results across studies, and accelerate progress in understanding the structure, function, and applications of S. loihica HtpX. Additionally, creating a centralized repository of protocols, reagents, and research materials would further support the research community working on this and related proteases.

How has the htpX gene evolved across different Shewanella species and what does this reveal about environmental adaptation?

The evolution of the htpX gene across different Shewanella species provides valuable insights into how these bacteria have adapted to diverse environmental niches. Although comprehensive evolutionary analyses specific to htpX are not directly presented in the search results, we can infer several important aspects of its evolution from the available information:

These evolutionary patterns highlight how comparative genomic approaches can reveal the adaptive mechanisms that have shaped membrane protein quality control systems across different bacterial species in response to specific environmental challenges.

What structural and functional differences exist between HtpX proteases from different bacterial species?

HtpX proteases from different bacterial species exhibit several structural and functional differences that reflect their adaptation to diverse cellular environments and physiological roles:

  • Domain organization and membrane topology: While all HtpX proteases are membrane-bound zinc metalloproteases, their specific membrane topology and domain organization may vary between species. In E. coli, HtpX has been characterized as having multiple transmembrane domains with its catalytic site positioned to access substrate proteins within the membrane environment . The specific arrangement of these domains might differ in S. loihica HtpX, potentially reflecting adaptations to the unique membrane composition or stress conditions encountered in deep-sea environments.

  • Substrate specificity profiles: Different bacterial species likely have evolved HtpX variants with distinct substrate recognition properties. In E. coli, HtpX has demonstrated activity against both membrane proteins like SecY and soluble proteins like casein . The substrate range and specificity of S. loihica HtpX might be tailored to the particular membrane proteins expressed in this species, especially those involved in its unique respiratory versatility.

  • Cofactor requirements and catalytic properties: While zinc dependency appears to be a conserved feature of HtpX proteases , the specific binding affinity for zinc and other potential cofactors might vary across species. Additionally, the optimal pH, temperature range, and catalytic efficiency could differ significantly between HtpX variants from thermophilic, psychrophilic, or mesophilic bacteria.

  • Regulatory mechanisms: The regulation of htpX expression varies considerably between bacterial species. In E. coli, htpX is under the control of the CpxR/CpxA extracytoplasmic stress response system , while in B. subtilis, the htpX homolog (ykrL) is repressed by Rok and YkrK . These different regulatory mechanisms reflect species-specific integration of membrane protein quality control into broader stress response networks.

  • Functional redundancy and essentiality: The degree to which HtpX function overlaps with other proteases differs across bacterial species. In E. coli, disruption of both htpX and ftsH results in thermosensitivity only in specific genetic backgrounds , suggesting partial functional redundancy. The extent of this redundancy in S. loihica may differ based on its complement of other membrane proteases and the specific challenges posed by its natural environment.

These structural and functional differences highlight how HtpX proteases have evolved to meet the specific requirements of different bacterial species, making comparative studies of these enzymes valuable for understanding both fundamental aspects of membrane protein quality control and the evolutionary mechanisms driving bacterial adaptation to diverse environments.

What are the most significant research papers and resources for studying Shewanella loihica Protease HtpX?

Based on the search results and the broader scientific literature, the following represent significant research papers and resources for studying Shewanella loihica Protease HtpX:

  • Foundational studies on HtpX proteases:

    • "Proteolytic activity of HtpX, a membrane-bound and stress-controlled protease from Escherichia coli" - While focusing on E. coli HtpX, this paper provides essential methodological approaches and fundamental insights into the biochemical characterization of HtpX proteases that can be applied to S. loihica HtpX.

  • Regulatory mechanisms of HtpX homologs:

    • "Regulation of ykrL (htpX) by Rok and YkrK, a Novel Type of Regulator in Bacillus subtilis" - This study explores how htpX homologs are regulated in Gram-positive bacteria, providing comparative context for understanding potential regulatory mechanisms in Shewanella.

  • Shewanella loihica genomic studies:

    • "Analyses of Current-Generating Mechanisms of Shewanella loihica PV-4" - This research examines the unique physiological capabilities of S. loihica PV-4, providing context for understanding the role of HtpX in this organism's membrane systems.

  • Comparative genomics of Shewanella species:

    • "Differential gene content and gene expression for bacterial evolution and physiological adaptation to different environments" - This paper compares gene content and expression between S. loihica PV-4 and S. oneidensis MR-1, offering insights into how genomic differences reflect adaptation to different environments.

  • Protease engineering and analysis resources:

    • Studies on recombinant expression and characterization of proteases from extremophiles provide methodological frameworks applicable to S. loihica HtpX research .

  • Biochemical characterization protocols:

    • Product information for recombinant HtpX proteins provides practical guidance on storage conditions, buffer compositions, and basic handling protocols .

  • Bioinformatic resources:

    • The Uniprot database (entry A3QDP2 for S. loihica HtpX) provides sequence information, predicted features, and comparative data with homologs from other species .

  • Genetic manipulation tools:

    • Protocols for genetic manipulation of Shewanella species, including gene knockout and expression systems, are essential for functional studies of htpX in its native context .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.