Recombinant Shewanella oneidensis Aquaporin Z (aqpZ)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

The protein is typically expressed in E. coli inclusion bodies and solubilized using detergents like n-dodecyl-β-D-maltopyranoside (DDM) to retain functionality . Key production parameters include:

ParameterDetailSource
Expression SystemE. coli
TagN-terminal 10xHis-tag
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 50% glycerol; avoid freeze-thaw

Regulation by the Arc System

  • aqpZ (locus tag: SO_1307) is part of the ArcA regulon, responding to redox conditions in S. oneidensis. Under anaerobic conditions, phosphorylated ArcA (ArcA-P) binds directly to the aqpZ promoter, modulating its expression .

  • Electrophoretic mobility shift assays (EMSAs) confirmed ArcA-P binding to the aqpZ promoter region at Z-score 3.0, indicating strong regulatory control .

Water Transport Activity

  • Recombinant AqpZ exhibits high water permeability comparable to native aquaporins, with no glycerol transport observed .

  • Functional assays using proteoliposomes demonstrate a water conduction rate of ~3×10^9 molecules/sec/channel .

Applications in Research

  • Structural Studies: Utilized in X-ray crystallography and cryo-EM to resolve aquaporin architecture .

  • Membrane Protein Assembly: Serves as a model for studying multimeric membrane protein folding .

  • Biotechnological Tools: Explored for biomimetic water filtration systems due to its selectivity .

Key Research Findings

  • Conserved Selectivity Mechanism: Despite structural similarities to E. coli AqpZ, S. oneidensis AqpZ lacks glycerol permeability, emphasizing pore-lining residue differences .

  • Stability: The recombinant protein retains functionality after lyophilization and reconstitution, enhancing experimental flexibility .

Comparative Analysis with Homologs

FeatureS. oneidensis AqpZE. coli AqpZ
Gene LocusSO_1307b1478
Regulatory SystemArcANot ArcA-regulated
Substrate SpecificityWater onlyWater only
Expression YieldHigh (via inclusion bodies)Moderate (membrane extraction)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
aqpZ; SO_1307; Aquaporin Z
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Shewanella oneidensis (strain MR-1)
Target Names
Target Protein Sequence
MNMSQKMAAEFLGTLWLVLGGCGSAVLAAAFPEVGIGLLGVSLAFGLTVLTMAFAIGHISGCHLNPAVSFGLWAGGRFPTSELLPYIIAQVAGGIAGAGVLYLIASGQEGFSLAAGFASNGFGEHSPGGYSMISVMICEIVMTLFFLLVILGSTDERAPKGFAPIAIGLCLTLIHLISIPISNTSVNPARSTGPALFVGDWAVSQLWLFWAAPIIGAILAGVIYRYFNAAK
Uniprot No.

Target Background

Function
Aquaporin Z (aqpZ) is a channel that facilitates the osmotically driven movement of water in both directions. It plays a role in osmoregulation and maintaining cell turgor during volume expansion in rapidly growing cells. AqpZ mediates rapid water entry or exit in response to abrupt changes in osmolarity.
Database Links

KEGG: son:SO_1307

STRING: 211586.SO_1307

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella oneidensis and why is it significant for aquaporin research?

Shewanella oneidensis MR-1 is a facultatively aerobic Gram-negative bacterium with remarkably diverse respiratory capabilities. This organism has gained attention as an important model for bioremediation studies due to its ability to reduce various metal ions and other electron acceptors under anaerobic conditions . Its genome consists of a 4,969,803 base pair circular chromosome with 4,758 predicted protein-encoding open reading frames and a 161,613 base pair plasmid with 173 CDSs .

While S. oneidensis is primarily studied for its electron transport capabilities, its membrane protein systems, including aquaporins, represent an important but less explored aspect of its cellular physiology. Aquaporin Z (aqpZ) in bacteria functions as a water channel protein that facilitates water movement across the cell membrane, playing crucial roles in osmoregulation and adaptation to environmental conditions .

How does bacterial Aquaporin Z differ from other aquaporin family proteins?

Aquaporin Z (AqpZ) is a bacterial water channel protein approximately 27 kDa in size that regulates bacterial cell volume and osmotic stress response . It belongs to the larger family of transmembrane proteins that facilitate water movement across cell membranes and shares structural similarities with other aquaporins, including the human aquaporin-4 (Aqp4) .

Sequence alignment analysis between bacterial AqpZ and human Aqp4 has revealed several regions of significant structural homology, with some overlapping important immune and disease-relevant epitopes . This homology is functionally significant, with both proteins serving as water channels, though bacterial AqpZ operates in the context of prokaryotic cell physiology while human Aqp4 functions primarily in the CNS, where it's expressed by astrocytes surrounding small blood vessels .

Unlike mammalian aquaporins that can demonstrate tissue-specific expression patterns, bacterial aquaporins like AqpZ typically function as general water channels throughout the organism. The structural conservation across this protein family suggests fundamental importance in cellular water homeostasis across different domains of life.

What are the optimal conditions for expressing recombinant S. oneidensis aqpZ in E. coli expression systems?

While specific conditions for S. oneidensis aqpZ expression are not directly covered in the search results, research on related aquaporins provides valuable guidance. Based on successful expression of AqpZ from Pseudomonas sp., optimal expression conditions typically involve:

  • Host strain: E. coli BL21(DE3) is a preferred expression host for membrane proteins including aquaporins

  • Induction parameters: 0.5 mM IPTG with incubation at 25°C for approximately 20 hours

  • Growth medium: LB or specialized media supplemented with appropriate antibiotics for plasmid selection

  • Vector selection: pET-based vectors with T7 promoter systems are commonly employed for controlled expression

When adapting these parameters to S. oneidensis aqpZ, researchers should consider the codon usage bias of S. oneidensis and potentially optimize codons for E. coli expression. The synthetic plasmid toolkit developed specifically for S. oneidensis MR-1 may offer additional genetic tools to enhance expression efficiency .

What are the most effective detergents and methods for solubilizing and purifying recombinant aqpZ?

Effective solubilization and purification of recombinant aquaporins requires careful selection of detergents and chromatography techniques:

DetergentConcentrationApplicationsNotes
CHAPS [(3-cholamidopropyl) dimethylammonio]-1-propanesulfonate8-10 mMInitial solubilizationZwitterionic mild detergent effective for membrane proteins
DDM (n-Dodecyl β-D-maltoside)1-2%Purification stagesOften used during chromatography steps
OG (n-Octyl-β-D-glucoside)0.5-1.5%Reconstitution preparationLess denaturing for functional studies

The purification workflow typically involves:

  • Cell lysis via sonication or French press in buffer containing protease inhibitors

  • Membrane fraction isolation through differential centrifugation

  • Detergent solubilization of membrane proteins

  • Affinity chromatography (typically using His-tag) for initial purification

  • Size-exclusion chromatography for final polishing and buffer exchange

For recombinant aquaporins, affinity chromatography has proven particularly effective when the protein is tagged appropriately, allowing for efficient one-step purification under conditions that maintain protein folding and activity .

How can water transport activity of recombinant S. oneidensis aqpZ be measured reliably?

Several complementary approaches can be employed to assess water transport activity of recombinant aquaporins:

  • Proteoliposome swelling assays: Purified aqpZ protein can be reconstituted into liposomes, and water permeability measured by monitoring the rate of liposome swelling in hypotonic solutions using light scattering techniques. Dynamic light scattering provides reliable measurements of particle size changes in liposome and proteoliposome preparations .

  • Stopped-flow spectroscopy: This technique measures the kinetics of water movement across membranes by rapidly mixing proteoliposomes with solutions of different osmolarity and monitoring the resulting volume changes through light scattering.

  • Expression in Xenopus oocytes: Functional complementation can be demonstrated by expressing aqpZ in Xenopus oocytes and measuring water permeability through osmotic swelling assays.

  • Yeast functional complementation: Expression of aqpZ in aquaporin-deficient yeast strains can restore osmotic stress tolerance, providing an in vivo functional assay.

For quantitative assessment, the osmotic water permeability coefficient (Pf) should be calculated from the initial rate of volume change under defined osmotic gradients, with proper controls including liposomes without incorporated protein.

What is the molecular basis for temperature adaptation in bacterial aquaporins, particularly in S. oneidensis?

The temperature adaptation of bacterial aquaporins involves specific structural modifications that maintain function under varying thermal conditions. While specific data for S. oneidensis aqpZ is not directly available in the search results, studies on psychrophilic aquaporins provide relevant insights:

Research on aquaporin Z from Pseudomonas sp. AMS3 (a psychrophilic bacterium) has revealed structural adaptations that enable function at low temperatures . These adaptations likely include:

  • Increased flexibility of loop regions to maintain conformational dynamics at lower temperatures

  • Modified amino acid composition with fewer proline and arginine residues in key regions

  • Altered hydrophobic core packing to maintain structural integrity while preserving necessary flexibility

  • Potentially reduced numbers of salt bridges and hydrogen bonds that could become restrictive at low temperatures

S. oneidensis, being adapted to diverse environments including low temperatures, may exhibit similar adaptations in its aquaporin structure. Comparative analysis of its aqpZ sequence with mesophilic and psychrophilic homologs could reveal specific amino acid substitutions associated with temperature adaptation. Such insights are valuable for potential low-temperature applications and molecular engineering purposes .

How does aqpZ expression and function integrate with S. oneidensis' unique respiratory capabilities?

S. oneidensis possesses remarkably diverse respiratory capabilities, utilizing a wide array of terminal electron acceptors including oxygen, metals (Mn(III/IV), Fe(III), Cr(VI), U(VI)), fumarate, nitrate, and various sulfur compounds . This respiratory versatility is mediated by complex electron transport systems involving numerous c-type cytochromes and other electron transfer proteins .

The integration of aqpZ with these metabolic processes likely involves several mechanisms:

  • Osmotic balance during respiratory transitions: As S. oneidensis shifts between aerobic and anaerobic respiration modes, cellular osmotic pressures may change, requiring regulated water transport through aqpZ to maintain cell volume homeostasis.

  • Support for metal reduction processes: The reduction of metal ions by S. oneidensis involves complex membrane-associated electron transport chains. AqpZ may contribute to maintaining proper membrane structure and hydration necessary for these processes.

  • Adaptation to environmental fluctuations: In redox-stratified environments where S. oneidensis thrives, rapid adaptation to changing conditions requires efficient water management systems. AqpZ likely plays a key role in this adaptation.

  • Potential involvement in proton transfer: While aquaporins primarily transport water, they may also facilitate the movement of protons, potentially contributing to proton motive force generation, which is crucial for energy conservation in S. oneidensis .

What role might aqpZ play in S. oneidensis biofilm formation and extracellular electron transfer?

S. oneidensis forms highly structured surface-attached communities (biofilms) that are crucial for its ecological functions and applications in bioremediation and bioelectrochemical systems. The potential roles of aqpZ in these processes include:

  • Biofilm matrix hydration: AqpZ likely contributes to water homeostasis within the biofilm matrix, affecting its mechanical properties and diffusion characteristics. Extracellular DNA (eDNA) serves as a structural component in all stages of S. oneidensis biofilm formation , and proper hydration is essential for eDNA function.

  • Osmoregulation during phage-induced lysis: Prophage-mediated lysis in S. oneidensis results in the release of biofilm-promoting factors, particularly eDNA . AqpZ may help regulate osmotic pressure during this controlled lysis process.

  • Support for extracellular electron transfer (EET): S. oneidensis' ability to transfer electrons to external acceptors requires complex membrane-associated protein systems. AqpZ may contribute to maintaining optimal membrane conditions for these electron transfer proteins to function.

  • Adaptation to redox-stratified environments: By facilitating rapid water movement in response to changing osmotic pressures, aqpZ helps S. oneidensis adapt to the varied conditions encountered in redox-stratified environments where it typically thrives.

Experimental evidence for these roles could be obtained through targeted mutagenesis of aqpZ genes coupled with biofilm formation assays and measurements of extracellular electron transfer rates.

How do the structural features of S. oneidensis aqpZ compare with other bacterial aquaporins, and what are the implications for water selectivity?

Aquaporins share a conserved structural arrangement consisting of six transmembrane α-helices and two half-helices forming a central water-conducting pore. The selectivity filter typically includes conserved NPA (asparagine-proline-alanine) motifs and an aromatic/arginine (ar/R) constriction region that determines water specificity and excludes protons.

A comprehensive structural comparison would include:

FeatureTypical Bacterial AqpZExpected S. oneidensis AqpZFunctional Implication
NPA motifsHighly conservedLikely conservedCritical for water selectivity and proton exclusion
ar/R constrictionConsists of F, H, R residuesMay have specific adaptationsDetermines pore size and selectivity
Loop regionsVariable length and compositionMay contain unique residuesAffects stability and potentially regulation
C-terminusOften involved in gatingMay have regulatory elementsCould influence response to osmotic stress

While the search results don't provide specific structural information about S. oneidensis aqpZ, analysis of its sequence compared to well-characterized bacterial aquaporins would reveal unique features that may relate to its function in this metal-reducing bacterium's specialized physiology.

What potential post-translational modifications occur in S. oneidensis aqpZ and how do they regulate channel activity?

Aquaporin regulation through post-translational modifications (PTMs) is an important mechanism for controlling water flux in response to environmental changes. While specific information about S. oneidensis aqpZ PTMs is not available in the search results, potential regulatory mechanisms can be inferred from research on other bacterial aquaporins:

  • Phosphorylation: Serine, threonine, or tyrosine residues in loop regions or the C-terminus may undergo phosphorylation, potentially affecting channel gating. In S. oneidensis, which possesses sophisticated signaling systems for environmental adaptation, phosphorylation could link osmotic sensing to aquaporin regulation.

  • Redox-based regulation: Given S. oneidensis' involvement in redox processes, its aqpZ might contain cysteine residues susceptible to oxidation/reduction, potentially creating a mechanism to respond to redox conditions by modulating water transport.

  • Metal ion interactions: As a metal-reducing bacterium, S. oneidensis experiences varying concentrations of metal ions. Specific metal binding sites on aqpZ could alter conformation and water transport activity in response to these fluctuations.

  • pH-dependent gating: Histidine residues in key positions could confer pH sensitivity, allowing the channel to respond to pH changes associated with different respiratory modes.

Experimental approaches to identify these modifications would include mass spectrometry of purified protein under different growth conditions, site-directed mutagenesis of potential modification sites, and functional assays comparing native and modified forms of the protein.

How can recombinant S. oneidensis aqpZ be utilized in bioremediation applications?

S. oneidensis is already recognized for its bioremediation potential due to its ability to reduce various metal pollutants including uranium (U) and chromium (Cr) . Incorporating knowledge about its aquaporin system could enhance these applications:

  • Engineered water channels for contaminant transport: Modified versions of S. oneidensis aqpZ could potentially be designed to facilitate the uptake of specific contaminants into the cell for subsequent detoxification.

  • Osmotic stress management in bioremediation settings: Overexpression or modification of aqpZ could enhance S. oneidensis survival in contaminated environments with variable osmotic conditions, improving bioremediation efficiency.

  • Biofilm optimization for metal reduction: Since biofilm formation is crucial for effective metal reduction by S. oneidensis , and aquaporins likely play a role in biofilm hydration, engineered aqpZ variants could potentially improve biofilm properties for enhanced bioremediation.

  • Integration with extracellular electron transfer: By ensuring optimal cellular water balance, enhanced aqpZ function could support the complex electron transfer systems required for metal reduction, potentially increasing the rate and extent of contaminant transformation.

Implementation would require genetic engineering approaches using the synthetic plasmid toolkit developed for S. oneidensis MR-1 to express modified aquaporins with enhanced or specialized functions.

What potential exists for cross-reactivity between bacterial and human aquaporins in biomedical research?

The significant structural homology between bacterial aquaporins like AqpZ and human aquaporins presents both challenges and opportunities for biomedical research:

  • Immunological cross-reactivity: Studies have demonstrated cross-immunoreactivity between bacterial aquaporin-Z and human aquaporin-4 proteins . This cross-reactivity has implications for understanding autoimmune conditions like neuromyelitis optica, where antibodies target human Aqp4.

  • Model systems for human aquaporin research: Bacterial aquaporins, being simpler and easier to express recombinantly, can serve as model systems for studying fundamental aspects of water channel structure and function relevant to human health.

  • Vaccine development considerations: The structural similarity between bacterial and human aquaporins necessitates careful design of vaccines targeting bacterial components to avoid potential cross-reactivity with human aquaporins.

  • Evolutionary insights: Comparative studies between S. oneidensis aqpZ and human aquaporins can provide insights into the evolution of these essential membrane proteins and their conserved functions across diverse life forms.

Researchers working with recombinant S. oneidensis aqpZ should be aware of these potential cross-reactivities, particularly when developing antibodies or other targeting molecules that might cross-react with human aquaporins.

What are the major challenges in expressing and purifying functional recombinant aqpZ, and how can they be overcome?

Membrane proteins like aquaporins present several technical challenges for recombinant expression and purification:

ChallengeSolution ApproachImplementation Details
Toxicity to expression hostUse tightly controlled induction systemsT7-based expression with glucose repression; lower induction temperatures (25°C) for 20+ hours
Inclusion body formationOptimize growth and induction conditionsReduce expression rate with lower IPTG concentrations (0.5 mM); use specialized E. coli strains like C41(DE3) or C43(DE3)
Membrane extractionSelect appropriate detergentsUse zwitterionic detergents like CHAPS for initial solubilization
Maintaining protein foldingBuffer optimizationInclude glycerol (10-20%) and appropriate salt concentrations in purification buffers
Assessing functionalityDevelop reliable activity assaysUse reconstituted proteoliposomes and dynamic light scattering to measure functional water transport

Additionally, fusion partners such as MBP (maltose-binding protein) or SUMO can improve solubility, while affinity tags positioned at either the N- or C-terminus facilitate purification. For S. oneidensis aqpZ specifically, codon optimization based on the organism's unique codon usage patterns may improve expression levels in E. coli hosts.

How can researchers effectively reconstitute purified aqpZ into liposomes for functional studies?

Successful reconstitution of purified aquaporins into liposomes is critical for functional characterization. The following stepwise protocol outlines an effective approach:

  • Lipid preparation:

    • Use a mixture of phospholipids (typically POPC, POPE, and cholesterol at a 7:2:1 ratio)

    • Dissolve lipids in chloroform, then evaporate under nitrogen to form a thin film

    • Hydrate the lipid film with buffer to form multilamellar vesicles

  • Liposome formation:

    • Subject the lipid suspension to freeze-thaw cycles (5-10 cycles)

    • Extrude through polycarbonate membranes (starting with 400 nm, then 200 nm, and finally 100 nm pores)

    • Verify liposome size distribution using dynamic light scattering

  • Protein incorporation:

    • Mix purified aqpZ with preformed liposomes at protein-to-lipid ratios between 1:50 and 1:200 (w/w)

    • Add detergent (typically OG or DDM) at concentrations just above CMC

    • Incubate at room temperature for 30-60 minutes with gentle agitation

  • Detergent removal:

    • Use Bio-Beads SM-2 or dialysis to remove detergent

    • Add Bio-Beads in a stepwise manner (three additions over 24 hours)

    • Monitor proteoliposome formation via dynamic light scattering

  • Functional verification:

    • Confirm protein incorporation using freeze-fracture electron microscopy or sucrose gradient centrifugation

    • Assess water transport function using stopped-flow spectroscopy or light scattering measurements

This protocol has been successfully applied to other bacterial aquaporins and should be adaptable to S. oneidensis aqpZ with potential adjustments to buffer composition based on the protein's specific stability requirements .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.