Recombinant Shewanella oneidensis ATP synthase subunit a (atpB) is a proton-translocating membrane protein critical for ATP synthesis in the facultative anaerobic bacterium S. oneidensis MR-1. This subunit forms part of the F<sub>O</sub> sector of the ATP synthase complex, which facilitates proton gradient-driven ATP production . Recombinant variants are engineered for biochemical and structural studies, enabling insights into bacterial energy metabolism and respiratory versatility.
Domains: Contains 264 amino acids with transmembrane helices critical for proton channel formation .
Expression: Produced in Escherichia coli with an N-terminal His tag for purification .
ATP synthase in S. oneidensis couples proton motive force (PMF) to ATP synthesis. Subunit a (atpB) anchors the F<sub>O</sub> sector, enabling proton translocation across the membrane . This activity supports anaerobic respiration, including extracellular electron transfer (EET) pathways linked to metal reduction .
Proton Transport Studies: Used to investigate PMF generation in diverse redox environments .
Structural Biology: Provides a model for resolving F<sub>O</sub> sector architecture .
Metabolic Engineering: Insights into ATP synthase function aid in optimizing bioelectrochemical systems .
The full-length protein sequence begins with:
MAAPGEALTPQGYIQHHLTNLHVGEGFWTWHIDSLFFSVGLGVLFLWIFRSVGKKATSGVP... .
ATP synthase activity in S. oneidensis is tightly linked to respiratory flexibility. Key connections include:
Formate Metabolism: Formate dehydrogenase complexes generate PMF, synergizing with ATP synthase for energy conservation .
Electron Transfer Pathways: c-type cytochromes (e.g., MtrCAB) channel electrons to extracellular acceptors, indirectly influencing ATP synthase demand .
Genetic Regulation: atpB is co-regulated with other ATP synthase subunits (atpA, atpE) under redox-varying conditions .
While recombinant atpB enables mechanistic studies, limitations persist:
Structural Resolution: Membrane protein crystallization remains technically challenging .
Functional Redundancy: Multiple PMF-generating systems in S. oneidensis complicate phenotype analysis .
Future work may leverage genetic code expansion or metabolic engineering to probe atpB’s role in synthetic bioenergetic systems.
KEGG: son:SO_4753
STRING: 211586.SO_4753
ATP synthase subunit a (atpB) is a critical membrane-embedded component of the Fo portion of ATP synthase in Shewanella oneidensis. This subunit forms part of the proton channel that allows H+ ions to flow through the membrane down their electrochemical gradient. In S. oneidensis, this process is particularly important as the organism has evolved diverse respiratory strategies that generate proton motive force under various environmental conditions.
The protein functions within the context of anaerobic metabolism, where S. oneidensis demonstrates remarkable versatility in utilizing different terminal electron acceptors. As documented in research on formate metabolism, S. oneidensis can generate proton motive force through multiple pathways, which ultimately drives ATP synthesis via the ATP synthase complex containing atpB . The ability to maintain energy production under variable environmental conditions makes this organism an excellent model for studying bacterial bioenergetics.
AtpB contains critical amino acid residues that facilitate proton translocation, making it essential for coupling electron transport to ATP synthesis. The protein's structure must maintain precise interactions with other ATP synthase subunits to ensure efficient energy conversion. Any significant alterations to atpB structure can severely impact the organism's ability to conserve energy from its diverse respiratory pathways.
Expressing recombinant membrane proteins like atpB presents significant challenges due to their hydrophobic nature and complex folding requirements. For S. oneidensis atpB, researchers have developed several effective expression strategies. The most successful approaches typically involve homologous expression systems that maintain the native cellular environment.
One promising approach leverages genetic code expansion technologies similar to those described for other S. oneidensis proteins . These methods allow for site-specific incorporation of noncanonical amino acids (ncAAs) into proteins, which can be particularly valuable for studying membrane proteins like atpB. Expression vectors such as pBAD derivatives, which have been successfully used for expressing other membrane proteins in S. oneidensis, can be adapted for atpB expression .
The expression protocol typically involves:
Constructing a plasmid containing the atpB gene with appropriate regulatory elements
Transforming the construct into S. oneidensis MR-1 or a related expression host
Inducing expression under controlled conditions (temperature, oxygen availability, carbon source)
Carefully extracting and purifying the membrane-bound protein using detergents
When using heterologous systems like E. coli, special considerations must be made for codon optimization and potential toxicity issues. The Gibson assembly method has proven effective for constructing expression vectors for S. oneidensis proteins and could be adapted for atpB expression .
S. oneidensis MR-1 possesses remarkable respiratory versatility, capable of utilizing over 20 different terminal electron acceptors. The ATP synthase complex, including atpB, plays a central role in harnessing the proton gradient generated by these diverse respiratory pathways. This versatility distinguishes S. oneidensis from many other bacterial species.
Studies on formate metabolism in S. oneidensis have demonstrated that formate oxidation contributes significantly to growth rate and yield through proton motive force generation . This proton motive force directly drives ATP synthesis via the ATP synthase complex containing atpB. Research has shown that formate oxidation is "a fundamental strategy under anaerobic conditions for energy conservation in S. oneidensis" .
The integration of atpB function with electron transport systems allows S. oneidensis to thrive in redox-stratified environments by coupling organic carbon oxidation to diverse terminal electron acceptors, ranging from soluble compounds to insoluble extracellular metal oxides and electrodes . This metabolic flexibility has made S. oneidensis valuable for applications in biotechnology, particularly in bioenergy and bioremediation contexts.
Comparative analyses with other bacterial species suggest that while the fundamental mechanism of ATP synthase is conserved, specific adaptations in atpB and other components may contribute to the unique metabolic capabilities of S. oneidensis, particularly its ability to efficiently generate ATP under varied environmental conditions.
Purifying functional membrane proteins like atpB presents multiple technical challenges that require specialized approaches. For S. oneidensis atpB, researchers have developed several effective strategies, though successful purification requires addressing multiple issues simultaneously.
The first challenge involves expressing sufficient quantities of the protein. Using strong, inducible promoters like those in pBAD-derived vectors has proven successful for other S. oneidensis membrane proteins . For atpB specifically, expression must be carefully controlled as overexpression can disrupt membrane integrity and cellular homeostasis.
For purification, a multi-step protocol is typically required:
Membrane fraction isolation: Following cell lysis, differential centrifugation separates membrane fractions containing atpB
Detergent solubilization: Critical for extracting membrane proteins while maintaining their native conformation. For atpB, mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin are often effective
Affinity chromatography: Adding purification tags (His-tag, Strep-tag) facilitates isolation, similar to the approach used for MtrC purification in S. oneidensis
Size exclusion chromatography: For removing aggregates and achieving higher purity
A key challenge is maintaining the native conformation and function of atpB during purification. Incorporating noncanonical amino acids (ncAAs) at specific sites can facilitate downstream analyses without disrupting function, as demonstrated with other S. oneidensis proteins . This approach allows for site-selective labeling and structural studies while preserving the protein's functional integrity.
Finally, reconstitution of purified atpB into proteoliposomes or nanodiscs may be necessary for functional studies, as this creates a membrane environment similar to the native bacterial membrane.
Genetic code expansion offers powerful approaches for investigating the structure-function relationships of complex membrane proteins like atpB. In S. oneidensis, recent advances have enabled site-specific incorporation of noncanonical amino acids (ncAAs) into proteins, providing unprecedented opportunities for studying membrane protein dynamics.
The methodology involves using orthogonal aminoacyl-tRNA synthetase/tRNA pairs to incorporate ncAAs at amber stop codons (UAG). For S. oneidensis specifically, researchers have successfully adapted two systems: the pyrrolysyl-tRNA synthetase (MbPylRS/tRNACUA) and tyrosyl-tRNA synthetase (MjCNFRS/tRNACUA) pairs . These have been introduced into expression vectors like pBAD derivatives through Gibson assembly cloning.
For atpB research, this technology enables:
Site-specific fluorescent labeling: By incorporating ncAAs with bioorthogonal functional groups, researchers can attach fluorophores to specific sites within atpB, allowing for precise visualization of protein localization and dynamics
Crosslinking studies: Photo-reactive ncAAs can be used to map protein-protein interactions between atpB and other ATP synthase subunits
Probing proton channels: Incorporating pH-sensitive ncAAs at key positions can provide insights into proton movement through atpB
Structural analysis: Site-specific incorporation of heavy-atom-containing ncAAs can facilitate X-ray crystallography or cryo-EM structural determination
The methodology has been proven compatible with S. oneidensis cellular machinery, showing that "the biosynthetic machinery for ncAA incorporation is compatible and orthogonal to the endogenous pathways of S. oneidensis MR-1 for protein synthesis, maturation of c-type cytochromes, and protein secretion" . These techniques could be directly applied to atpB to gain unprecedented insights into its structure and function.
In S. oneidensis, formate metabolism plays a crucial role in generating proton motive force (PMF), which directly drives ATP synthesis via the ATP synthase complex containing atpB. Recent research has quantified this relationship, demonstrating that "formate oxidation contributes to both the growth rate and yield of S. oneidensis through the generation of proton motive force" .
The pathway operates as follows:
Formate is oxidized to CO2 by formate dehydrogenases
This oxidation releases electrons and protons
Electrons enter the respiratory chain and are transferred to terminal electron acceptors
Protons are released outside the cell, generating or enhancing the PMF
ATP synthase (including atpB) utilizes this PMF to generate ATP
This mechanism is particularly important under anaerobic conditions, where S. oneidensis displays remarkable metabolic versatility. Research has revealed that formate oxidation "is a fundamental strategy under anaerobic conditions for energy conservation in S. oneidensis" . The organism contains multiple formate dehydrogenase gene clusters, highlighting the importance of this metabolic pathway.
The integration of formate metabolism with ATP synthase function allows S. oneidensis to thrive in environments with fluctuating redox conditions. This metabolic flexibility contributes to the organism's ability to "couple the oxidation of organic carbon or hydrogen to a diverse array of terminal electron acceptors" . The ATP synthase complex, with atpB as a critical component, serves as the final link in converting the energy stored in the PMF into ATP for cellular processes.
Mutations in conserved residues of atpB can profoundly impact ATP synthesis and the broader electron transfer capabilities of S. oneidensis. By strategically introducing mutations, researchers can probe the structure-function relationships of this crucial membrane protein and its role in cellular energetics.
Key experimental approaches include:
Site-directed mutagenesis: Targeted mutations at conserved residues, particularly those involved in proton translocation, can reveal their specific contributions to ATP synthase function
Genetic code expansion: Incorporating noncanonical amino acids at specific positions offers a sophisticated approach to introducing subtle changes to atpB structure
Functional assays: Measuring ATP synthesis rates, proton pumping efficiency, and growth under various conditions provides quantitative assessment of mutation effects
One particularly informative approach combines these techniques with the organism's diverse respiratory capabilities. By examining how specific atpB mutations affect growth with different terminal electron acceptors, researchers can connect ATP synthase function to the broader electron transfer network.
Studies of formate metabolism in S. oneidensis provide a model for how such experiments might be designed. Research has shown that disruptions in energy conservation pathways can have unexpected effects on the organism's ability to utilize different electron acceptors . Similar approaches could reveal how atpB mutations impact the integration of ATP synthesis with electron transport chains.
Interestingly, some mutations might differentially affect the organism's ability to use soluble versus insoluble electron acceptors, potentially providing insights into how energy conservation mechanisms are adapted to different environmental conditions.
Expressing and purifying functional recombinant atpB requires careful optimization of multiple parameters to maintain protein stability and function. Based on successful approaches with other S. oneidensis membrane proteins, the following conditions typically yield the best results:
Expression conditions:
Host selection: While homologous expression in S. oneidensis often produces properly folded protein, engineered E. coli strains like C41(DE3) or C43(DE3) can provide higher yields
Temperature: Lower temperatures (16-20°C) typically improve proper folding of membrane proteins
Induction conditions: Gradual induction using arabinose with pBAD vectors has proven effective for other S. oneidensis membrane proteins
Media supplementation: Adding specific lipids can stabilize membrane proteins during expression
For purification, a carefully designed protocol is essential:
Purification conditions:
Membrane isolation: Gentle lysis followed by ultracentrifugation at 100,000 × g
Solubilization: Initial screening of multiple detergents is recommended; DDM, LMNG, or digitonin often preserve atpB function
Buffer optimization: Including glycerol (10-20%) and specific lipids helps maintain protein stability
Purification tags: C-terminal tags generally interfere less with function than N-terminal tags
Chromatography sequence: Affinity chromatography followed by size exclusion chromatography in optimized buffers
For functional studies, purified atpB is typically reconstituted into liposomes or nanodiscs. The technique used for cytochrome proteins in S. oneidensis, where "site-specifically incorporated bioorthogonal functional groups could be used for efficient site-selective labeling," can be adapted for atpB . This approach allows for detailed functional analysis while minimizing structural disruption.
Investigating protein-protein interactions involving atpB requires sophisticated techniques that can capture these interactions in their native membrane environment. Several cutting-edge approaches have proven particularly valuable for studying membrane protein complexes like ATP synthase.
Crosslinking Mass Spectrometry (XL-MS): This technique combines chemical crosslinking with mass spectrometry to map protein-protein interaction interfaces. For atpB research, genetic code expansion can facilitate site-specific incorporation of photo-crosslinkable amino acids, allowing precisely targeted crosslinking experiments . The crosslinked proteins are digested and analyzed by mass spectrometry to identify interaction sites with single-residue resolution.
Cryo-Electron Microscopy (Cryo-EM): Recent advances in cryo-EM have revolutionized the study of membrane protein complexes. For ATP synthase, this technique has enabled visualization of the complete complex, including the membrane-embedded Fo portion containing atpB. Sample preparation typically involves purification in amphipathic detergents or reconstitution into nanodiscs.
Förster Resonance Energy Transfer (FRET): By incorporating fluorescent probes at specific sites in atpB and other subunits, researchers can measure distances between protein components with nanometer precision. The genetic code expansion technology developed for S. oneidensis enables site-specific labeling of proteins, making this approach particularly powerful .
Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique measures the exchange rate of hydrogen atoms in the protein backbone with deuterium from the solvent, providing information about protein dynamics and solvent accessibility. HDX-MS can reveal conformational changes in atpB during interaction with other subunits.
Native Mass Spectrometry: This emerging technique maintains non-covalent interactions during mass spectrometry analysis, allowing direct measurement of intact protein complexes. For membrane proteins like atpB, specialized detergents or nanodiscs are used to maintain the native structure during analysis.
Recombinant atpB can serve as a cornerstone for developing sophisticated in vitro systems to study ATP synthesis under controlled conditions. These systems allow researchers to manipulate specific parameters and measure ATP synthase function with precision not possible in whole-cell studies.
The development process typically involves several key steps:
Reconstitution into proteoliposomes: Purified atpB must be co-reconstituted with other ATP synthase subunits into liposomes to recreate the native membrane environment. The lipid composition is critical and should mimic the bacterial inner membrane. Successful reconstitution can be verified using freeze-fracture electron microscopy or functional assays.
Establishing a proton gradient: ATP synthesis requires a proton motive force, which can be generated using several approaches:
pH jump: Creating an acidic exterior and basic interior
Valinomycin-induced potassium diffusion: Generating a membrane potential
Bacteriorhodopsin co-reconstitution: Light-driven proton pumping
Measurement systems: Several techniques can quantify ATP synthesis:
Luciferase-based luminescence assays for real-time ATP detection
Radio-labeled ADP incorporation into ATP
HPLC analysis of nucleotide conversion
An advanced approach involves tethering proteoliposomes containing the reconstituted ATP synthase to a surface and using fluorescent probes to monitor both proton movement and ATP synthesis simultaneously. This setup allows for single-molecule studies of ATP synthase function.
The genetic code expansion technology developed for S. oneidensis proteins offers unique advantages for these systems . By incorporating bioorthogonal functional groups at specific sites in atpB, researchers can attach fluorescent probes, photoactivatable groups, or other modifications that facilitate detailed mechanistic studies without disrupting protein function.
Several cutting-edge technologies are poised to transform our understanding of atpB function in S. oneidensis, offering unprecedented resolution in structural and functional studies.
Cryo-Electron Tomography (Cryo-ET): This technique allows visualization of membrane proteins in their native cellular context, potentially revealing how ATP synthase complexes are organized within the bacterial membrane. When combined with focused ion beam (FIB) milling, cryo-ET can provide 3D images of intact bacterial cells with molecular resolution, showing the spatial relationship between ATP synthase and other cellular components.
Single-Molecule FRET (smFRET): By labeling specific residues in atpB with fluorescent probes, researchers can track conformational changes during ATP synthesis in real-time. The genetic code expansion technology developed for S. oneidensis makes this approach particularly promising, as it allows site-specific incorporation of noncanonical amino acids for fluorescent labeling .
In-cell NMR Spectroscopy: Recent advances have made it possible to perform NMR studies in living cells, potentially allowing researchers to probe atpB structure and dynamics under physiological conditions. This approach could reveal how the protein responds to changes in cellular energetics or environmental conditions.
AlphaFold2 and Molecular Dynamics Simulations: The revolution in protein structure prediction, combined with advanced simulation techniques, enables detailed computational studies of atpB function. These approaches can model proton movement through the protein, conformational changes during ATP synthesis, and interactions with other subunits.
Genome-Scale Metabolic Modeling: Integrating ATP synthase function into whole-cell metabolic models could provide insights into how atpB contributes to the remarkable metabolic versatility of S. oneidensis. These models can predict how changes in ATP synthase function would affect the organism's ability to utilize different electron acceptors, complementing experimental approaches.
The study of atpB in S. oneidensis has significant implications for developing advanced bioenergy and bioremediation technologies, leveraging the organism's unique metabolic capabilities.
In bioenergy applications, understanding atpB function could lead to engineered strains with enhanced energy conservation efficiency. Research has demonstrated that S. oneidensis can couple organic carbon oxidation to electricity generation in microbial fuel cells . By optimizing ATP synthase function through targeted modifications of atpB, researchers might develop strains that produce higher power outputs or operate more efficiently under specific conditions.
The relationship between formate metabolism and ATP synthesis offers particular promise. Studies have shown that "formate oxidation contributes to both the growth rate and yield of S. oneidensis through the generation of proton motive force" . Engineering this pathway in conjunction with ATP synthase could create strains that more efficiently convert organic waste into electricity or value-added products.
For bioremediation applications, S. oneidensis's ability to respire diverse electron acceptors, including metal oxides and contaminants, depends on efficient energy conservation. Optimizing ATP synthase function could enhance the organism's ability to grow under challenging conditions found in contaminated sites. Engineered strains with modified atpB could potentially demonstrate:
Faster growth rates in contaminated environments
Improved metal reduction capabilities
Enhanced tolerance to environmental stressors
More efficient conversion of contaminants to less harmful forms
Additionally, the techniques developed for studying atpB, particularly genetic code expansion approaches, could be applied to other proteins involved in extracellular electron transfer, providing new tools for engineering enhanced bioremediation capabilities .