Recombinant Shewanella oneidensis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Functional Role in Phospholipid Biosynthesis

PlsY is the first enzyme in the phospholipid biosynthesis pathway :

  1. Transfers an acyl group to glycerol-3-phosphate, forming LPA.

  2. LPA is further acylated at the sn-2 position by PlsC to generate phosphatidic acid (PA), a precursor for phospholipids like phosphatidylethanolamine (PE) and phosphatidylglycerol (PG) .

In Shewanella, phospholipid composition is critical for membrane fluidity under stress conditions (e.g., low temperature or high pressure) . Although plsY is conserved across Shewanella species, its activity influences the incorporation of specialized fatty acids like eicosapentaenoic acid (EPA) into membrane lipids .

Recombinant Expression and Purification

Recombinant PlsY is produced in E. coli systems for functional studies. Key protocols include:

  • Cloning: Full-length plsY (1–203 aa) fused to an N-terminal His tag .

  • Purification: Affinity chromatography using the His tag, yielding >90% pure protein .

  • Storage: Stabilized in Tris-based buffer with 50% glycerol at -20°C or -80°C .

This recombinant form retains enzymatic activity, enabling in vitro assays to study substrate specificity and kinetics .

Biochemical Characterization

  • Substrate Specificity: Prefers acyl-phosphate donors (e.g., palmitoyl-phosphate) over acyl-CoA or acyl-ACP .

  • Catalytic Efficiency: Optimal activity at neutral pH and 25–30°C, consistent with Shewanella’s mesophilic habitat .

Genetic Studies

  • Gene Knockout Effects: plsY deletion in Shewanella disrupts phospholipid synthesis, leading to defective cell membranes and impaired growth under cold stress .

  • EPA Incorporation: While PlsY itself does not directly incorporate EPA, its product (LPA) is a substrate for PlsC enzymes that integrate EPA at the sn-2 position .

Biotechnological Applications

  • Model for Lipid Metabolism: Used to engineer Shewanella strains with modified membrane lipids for industrial applications (e.g., bioremediation, bioelectrochemical systems) .

  • Enzyme Engineering: Structure-guided mutagenesis of PlsY aims to optimize lipid production in synthetic biology .

Future Directions

Current research focuses on:

  • Resolving the crystal structure of PlsY to elucidate its catalytic mechanism .

  • Engineering thermostable variants for industrial processes .

  • Investigating regulatory interactions between PlsY and other lipid biosynthesis enzymes (e.g., PlsC, Fab proteins) .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Please note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; SO_1290; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Shewanella oneidensis (strain MR-1)
Target Names
plsY
Target Protein Sequence
MSQLSLTLLMIVAAYLAGSVSSAVLVCRMRGLPDPRSQGSGNPGATNVLRIGGASSAAMV LFFDMLKGALPTYLAYLMGIDAISLGLIAIAACLGHIYPVFFGFKGGKGVATAFGAMAPI GDDLAICLMASWVVLVLISRYSSLAAIITALLAPLYTWWLDDRFTIPVAMLSTLIIIRHK DNIKRLLKGEESKVSRKRRPKIP
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: son:SO_1290

STRING: 211586.SO_1290

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella oneidensis MR-1 and why is it important for biotechnology research?

Shewanella oneidensis MR-1 is a versatile bacterium renowned for its remarkable broad respiratory capabilities. It can respire ("breathe") oxygen and, in oxygen-depleted environments, utilize alternative compounds including metals and radionuclides as electron acceptors. This unique metabolic flexibility makes S. oneidensis an invaluable model organism for bioremediation of toxic and radioactive metals and for understanding extracellular electron transfer mechanisms .

The bacterium serves as a model electroactive bacterium (EAB) with significant potential for biotechnological applications. Its ability to adapt rapidly to environmental changes is facilitated by mobile genetic elements that enable the acquisition of new genetic material and functions. This adaptability allows S. oneidensis to thrive in diverse environmental niches and potentially develop enhanced capabilities for bioremediation tasks .

Several Shewanella strains have demonstrated the ability to degrade environmental contaminants such as cyclotrimethylenetrinitramine (RDX) and halogenated ethenes like tetrachloroethene, further highlighting their bioremediation potential .

What is the structure and function of bacterial glycerol-3-phosphate acyltransferase (PlsY)?

Glycerol-3-phosphate acyltransferase (PlsY) is an integral membrane protein that catalyzes a critical step in bacterial membrane phospholipid biosynthesis. Specifically, PlsY transfers an acyl group from acylphosphate to glycerol-3-phosphate, initiating the formation of phosphatidic acid, which is a precursor for membrane phospholipids .

Structurally, PlsY (as characterized in Streptococcus pneumoniae) features five membrane-spanning segments with the amino terminus and two short loops positioned on the external face of the membrane. The protein contains three larger cytoplasmic domains, each possessing a highly conserved sequence motif that is essential for catalytic function :

  • Motif 1 contains essential serine and arginine residues critical for catalysis

  • Motif 2 functions as a phosphate-binding loop and serves as the glycerol-3-phosphate binding site

  • Motif 3 includes conserved histidine and asparagine residues important for enzymatic activity, along with a glutamate residue crucial for structural integrity

These structural features enable PlsY to effectively position the substrates for catalysis while anchored within the cell membrane. The enzyme is noncompetitively inhibited by palmitoyl-CoA, suggesting complex regulatory mechanisms for its activity .

How does PlsY differ from other glycerol-3-phosphate acyltransferases in cellular metabolism?

PlsY represents a distinct class of acyltransferases that differs from other GPATs in several key aspects:

  • Substrate specificity: Unlike mammalian GPATs that utilize acyl-CoA as the acyl donor, bacterial PlsY uses acylphosphate generated by the PlsX enzyme from acyl-acyl carrier protein (acyl-ACP) .

  • Membrane topology: PlsY has a unique topology with five membrane-spanning segments, whereas mammalian GPATs (GPAT1-4) typically have different membrane arrangements depending on whether they are mitochondrial (GPAT1, GPAT2) or endoplasmic reticulum-associated (GPAT3, GPAT4) .

  • Metabolic role: In bacteria, PlsY functions primarily in membrane phospholipid synthesis, while mammalian GPATs play broader roles in both phospholipid and triglyceride synthesis, with implications for metabolic diseases such as obesity, hepatic steatosis, and insulin resistance .

  • Catalytic mechanism: PlsY employs distinct functional motifs for substrate binding and catalysis, as revealed by site-directed mutagenesis studies. The enzyme's three conserved motifs are uniquely arranged to facilitate the acyltransferase reaction in the bacterial context .

This comparison is summarized in the following table:

CharacteristicBacterial PlsYMammalian GPATs
Acyl donorAcylphosphateAcyl-CoA
Subcellular localizationBacterial membraneMitochondrial (GPAT1,2) or ER (GPAT3,4)
Primary metabolic rolePhospholipid synthesisPhospholipid and triglyceride synthesis
Disease implicationsNot applicableObesity, insulin resistance, hepatic steatosis
Number of isoformsOne in most bacteriaFour identified isoforms in mammals

What are the optimal methods for recombinant expression of S. oneidensis PlsY?

The recombinant expression of S. oneidensis PlsY requires careful consideration of multiple factors to achieve functional protein production. Based on the available data and established protocols for membrane proteins, the following methodological approach is recommended:

  • Vector selection and design: Construct an expression vector containing the PlsY gene from S. oneidensis with appropriate promoters (inducible systems like IPTG-inducible T7 promoter) and affinity tags (His-tag or FLAG-tag) for purification. Include fusion partners if needed to enhance solubility.

  • Expression host: While E. coli is commonly used for heterologous protein expression, homologous expression in S. oneidensis itself may yield better results for membrane proteins due to compatible membrane composition and folding machinery. The new electroporation method for S. oneidensis with an efficiency of ~4.0 × 10^6 transformants/μg DNA enables efficient transformation for homologous expression .

  • Growth conditions: Optimize culture temperature (often lowered to 16-20°C after induction), media composition, and induction parameters. For membrane proteins, slower expression at lower temperatures generally improves proper folding.

  • Membrane protein extraction: Use gentle detergents (DDM, LDAO, or Triton X-100) to solubilize the membrane fraction while maintaining protein structure and function. Test multiple detergents to identify optimal conditions.

  • Purification strategy: Implement a two-step purification approach using affinity chromatography followed by size exclusion chromatography to obtain pure, homogeneous protein.

For functional characterization, it's essential to verify that the recombinant PlsY retains its catalytic activity by employing enzymatic assays that measure the transfer of acyl groups to glycerol-3-phosphate.

How can genome editing techniques be applied to study PlsY function in S. oneidensis?

Recent advances in genome editing techniques for S. oneidensis have opened new possibilities for studying PlsY function through precise genetic modifications. The following methodological approach leverages these new tools:

  • Recombineering system application: Utilize the prophage-mediated genome engineering (recombineering) system developed for S. oneidensis that employs the λ Red Beta homolog from Shewanella sp. W3-18-1. This system has demonstrated high efficiency (~5 × 10^6 recombinants in 10^8 viable cells) for single-stranded DNA oligonucleotide-mediated recombination .

  • Targeted mutagenesis strategies:

    • Design single-stranded DNA oligonucleotides (50-70 nucleotides) targeting specific residues in the conserved motifs of PlsY

    • Introduce point mutations to assess the functional significance of key amino acids (e.g., the essential serine and arginine in Motif 1)

    • Create deletion or insertion mutations to study domain functions

    • Introduce reporter tags for localization studies

  • Transformation protocol: Employ the optimized electroporation method for S. oneidensis with an efficiency of ~4.0 × 10^6 transformants/μg DNA. Cells prepared for electroporation can be frozen for long-term storage without significant loss of transformation efficiency .

  • Screening and verification: Design PCR-based screening methods to identify successful recombinants, followed by sequencing verification of the targeted modifications.

  • Phenotypic characterization: Assess the impact of mutations on:

    • Growth rates in various media

    • Membrane composition analysis

    • Stress response parameters

    • Electron transfer capabilities if relevant to the specific research question

The W3 Beta recombinase system is particularly valuable as it outperforms other tested recombinases (RecT) in S. oneidensis, demonstrating the importance of using species-specific or closely related recombination systems .

What assays can be used to measure PlsY activity in vitro and in vivo?

To comprehensively characterize PlsY activity, researchers should employ complementary in vitro and in vivo approaches:

In vitro assays:

  • Radiometric acyltransferase assay: Use radiolabeled substrates (typically 14C or 3H-labeled glycerol-3-phosphate) to measure the transfer of acyl groups from acylphosphate to glycerol-3-phosphate. Products can be separated by thin-layer chromatography and quantified by scintillation counting.

  • Spectrophotometric coupled assay: Measure PlsY activity by coupling the reaction to an indicator reaction that produces a spectrophotometric readout, such as NADH oxidation.

  • Mass spectrometry-based assay: Quantify the formation of lysophosphatidic acid using LC-MS/MS for sensitive and specific detection of reaction products.

  • Binding affinity determination: Employ isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to characterize the binding of substrates to PlsY, particularly to investigate the interaction with glycerol-3-phosphate in the conserved Motif 2 region .

In vivo assays:

  • Genetic complementation: Test the ability of PlsY variants to complement growth defects in PlsY-deficient strains under various conditions.

  • Metabolic labeling: Use radioactive or isotope-labeled precursors to track phospholipid synthesis in living cells with modified PlsY.

  • Membrane composition analysis: Quantify changes in membrane phospholipid profiles using lipidomics approaches in response to PlsY modifications.

  • Growth phenotyping: Assess growth characteristics of strains with PlsY mutations across different environmental conditions to correlate enzymatic activity with physiological outcomes.

When designing experiments to investigate the three conserved motifs, researchers should focus on:

  • Motif 1: Mutations of serine and arginine residues to assess their role in catalysis

  • Motif 2: Glycine-to-alanine mutations to probe glycerol-3-phosphate binding

  • Motif 3: Mutations of histidine, asparagine, and glutamate to examine their roles in activity and structural integrity

How can S. oneidensis PlsY be engineered to enhance bioremediation applications?

Engineering S. oneidensis PlsY for enhanced bioremediation requires sophisticated approaches that leverage the bacterium's unique metabolic capabilities while optimizing membrane properties for environmental applications:

  • Rational engineering based on structure-function analysis:

    • Modify conserved motifs to alter substrate specificity, potentially enabling the incorporation of alternative acyl chains that might enhance membrane stability under toxic conditions

    • Engineer the phosphate-binding loop in Motif 2 to optimize glycerol-3-phosphate binding kinetics under varying environmental conditions

    • Introduce mutations to reduce product inhibition, potentially increasing metabolic flux through the phospholipid synthesis pathway

  • Environmental adaptation engineering:

    • Develop PlsY variants with enhanced stability at extreme pH, temperature, or in the presence of contaminants

    • Engineer the enzyme to function optimally in environments with high concentrations of heavy metals or radionuclides

    • Modify regulatory elements to maintain appropriate PlsY expression levels under stress conditions

  • Integrated systems approach:

    • Coordinate PlsY engineering with modifications to other components of membrane biogenesis

    • Couple PlsY modifications with enhancements to the bacterium's extracellular electron transfer systems

    • Optimize the balance between membrane phospholipid composition and the expression of metal reductases

The remarkable respiratory capabilities of S. oneidensis, including its ability to respire radionuclides and degrade compounds like RDX and halogenated ethenes, make it an excellent platform for bioremediation . By engineering PlsY to produce membrane compositions that support these activities under challenging environmental conditions, researchers can potentially enhance the bacterium's bioremediation efficacy.

What role does PlsY play in S. oneidensis adaptation to different environmental stresses?

PlsY plays a crucial role in S. oneidensis adaptation to environmental stresses by mediating changes in membrane phospholipid composition, which directly affects membrane fluidity, permeability, and functionality under varying conditions:

  • Metal stress adaptation:

    • PlsY activity likely contributes to membrane remodeling in response to heavy metal exposure, potentially altering phospholipid composition to reduce metal permeability or toxicity

    • The enzyme may participate in stress response pathways that help maintain membrane integrity when S. oneidensis is exposed to radionuclides during bioremediation activities

  • Oxygen availability response:

    • PlsY function may be regulated differently under aerobic versus anaerobic conditions, contributing to the remarkable respiratory flexibility of S. oneidensis

    • Membrane composition changes mediated by PlsY could support the transition between oxygen and alternative terminal electron acceptors like metals and radionuclides

  • Temperature adaptation:

    • PlsY activity may adjust to incorporate different acyl chains into membrane phospholipids in response to temperature shifts, maintaining appropriate membrane fluidity

    • This adaptation mechanism would be particularly important for environmental applications where temperature fluctuations are common

  • Integration with mobile genetic elements:

    • The genome of S. oneidensis MR-1 contains nearly 300 mapped mobile elements that contribute to rapid evolution in response to environmental changes

    • PlsY function may be modulated through genetic changes resulting from mobile element activity, potentially creating variants with altered substrate specificity or regulatory properties

S. oneidensis has demonstrated an enhanced ability to acquire or evolve new functions compared to other bacteria, possibly due to the numerous repetitions of structural elements within its genome . This genomic plasticity, coupled with the fundamental role of PlsY in membrane biogenesis, suggests that PlsY adaptation is likely a key mechanism in the bacterium's remarkable environmental versatility.

How does PlsY interact with the extracellular electron transfer mechanisms in S. oneidensis?

The interaction between PlsY and extracellular electron transfer (EET) mechanisms in S. oneidensis represents a fascinating intersection of membrane biogenesis and bioenergetics:

  • Membrane composition effects on electron transfer proteins:

    • PlsY-mediated phospholipid synthesis establishes the membrane environment in which EET proteins function

    • The composition of phospholipids in the membrane can affect the proper folding, localization, and activity of outer membrane cytochromes and other components of the EET machinery

    • Specific phospholipid compositions may facilitate the formation of specialized membrane domains where EET components cluster for efficient electron transfer

  • Metabolic coordination:

    • PlsY activity requires energy in the form of acylphosphate, linking membrane biogenesis to cellular energetics

    • Under conditions where S. oneidensis performs EET, energy conservation and distribution pathways may prioritize essential processes like membrane maintenance through PlsY activity

    • The balance between energy allocation to phospholipid synthesis versus EET may be a critical regulatory point during adaptation to different electron acceptors

  • Biofilm formation and electrode interactions:

    • S. oneidensis serves as a model electroactive bacterium for electro-biotechnology applications

    • Membrane properties determined partly by PlsY activity influence bacterial adhesion to electrodes and biofilm formation

    • Phospholipid composition can affect cell surface charge and hydrophobicity, potentially influencing the efficiency of electron transfer between bacterial cells and electrodes

  • Adaptation to electrode-associated growth:

    • When S. oneidensis is grown in bioelectrochemical systems, PlsY activity may adapt to optimize membrane properties for this specialized niche

    • Changes in membrane composition could enhance conductivity or facilitate the arrangement of EET components at the cell-electrode interface

Understanding these interactions could lead to engineered strains with optimized membrane compositions for enhanced performance in bioelectrochemical systems, potentially advancing applications in microbial fuel cells, biosensors, and bioelectrosynthesis .

How should researchers approach unexpected results when studying recombinant PlsY?

When confronted with unexpected results in recombinant PlsY studies, researchers should follow a systematic approach to troubleshooting:

  • Thoroughly examine the data:

    • Identify specific discrepancies between expected and observed results

    • Pay special attention to outliers that may have influenced the results

    • Compare findings with existing literature on PlsY and related acyltransferases

    • Conduct a comprehensive analysis to gain deeper insights into the contradictions

  • Evaluate experimental design and assumptions:

    • Reassess the initial hypothesis and underlying assumptions

    • Review the experimental conditions, including expression system, purification methods, and assay parameters

    • Consider whether the recombinant construct (tags, fusion partners) might affect protein function

    • Examine potential differences between the native bacterial environment and experimental conditions

  • Investigate alternative explanations:

    • Consider whether PlsY might have unexpected substrate preferences in S. oneidensis compared to other bacteria

    • Explore potential post-translational modifications or protein-protein interactions

    • Examine whether the enzyme might have secondary functions beyond its canonical acyltransferase activity

    • Assess whether the unexpected results might actually represent a novel discovery about PlsY function

  • Refine methodological approach:

    • Modify data collection processes if necessary

    • Implement additional controls to validate observations

    • Refine variables and experimental parameters

    • Consider alternative assay methods that might provide complementary data

The table below outlines common unexpected results in PlsY studies and potential troubleshooting approaches:

Unexpected ResultPotential CausesTroubleshooting Approaches
Low or no enzymatic activityImproper protein folding, inactive conformation, missing cofactorsTry different detergents, add potential cofactors, vary pH and salt conditions
Unusual substrate specificitySpecies-specific differences, assay conditions affecting bindingTest broader range of substrates, modify assay conditions
Inconsistent membrane localizationFusion tags affecting targeting, overexpression artifactsUse alternative tagging strategies, reduce expression levels
Unexpected phenotypes in mutantsCompensatory pathways, polar effects on neighboring genesCreate clean deletions, complementation studies, analyze global effects

Remember that unexpected results often lead to new discoveries and research directions. Approaching contradictory data with scientific rigor and an open mind can transform challenges into opportunities for advancing knowledge .

What are the key considerations for optimizing PlsY expression and purification?

Optimizing the expression and purification of recombinant PlsY requires attention to several critical factors due to its nature as an integral membrane protein with multiple transmembrane segments:

  • Expression system optimization:

    • Host selection: Compare expression in E. coli vs. native S. oneidensis. The latter may provide a more suitable membrane environment for proper folding but might yield lower protein quantities.

    • Induction parameters: Test various inducer concentrations and induction temperatures (typically 16-20°C) to balance expression level with proper folding.

    • Growth media: Specialized media formulations can improve membrane protein expression. Consider testing auto-induction media or media supplemented with specific phospholipids.

    • Expression constructs: Design constructs with varying fusion partners (MBP, SUMO, GFP) that can improve folding and provide indicators of expression quality.

  • Membrane extraction considerations:

    • Cell disruption method: Gentle lysis methods (e.g., osmotic shock, enzymatic lysis) may better preserve membrane integrity compared to sonication or high-pressure homogenization.

    • Buffer composition: Include glycerol (10-20%) and appropriate protease inhibitors to stabilize the protein during extraction.

    • Detergent screening: Test a panel of detergents for membrane solubilization, including:

      • Mild detergents: DDM, LMNG, Digitonin

      • Moderate detergents: DM, LDAO

      • Harsher detergents: OG, Triton X-100

    • Solubilization conditions: Optimize detergent concentration, temperature, and duration for membrane solubilization.

  • Purification strategy:

    • Affinity purification: Select appropriate affinity tags based on the specific properties of PlsY (His-tag, FLAG-tag, etc.).

    • Buffer optimization: Include specific lipids in purification buffers to maintain the native lipid environment critical for membrane protein stability.

    • Size exclusion chromatography: Implement as a second purification step to separate properly folded protein from aggregates.

    • Quality assessment: Use techniques like circular dichroism or thermal shift assays to evaluate protein folding and stability throughout the purification process.

  • Activity preservation:

    • Stabilizing additives: Include glycerol, specific phospholipids, or cholesterol hemisuccinate in storage buffers.

    • Storage conditions: Optimize protein concentration, buffer composition, and storage temperature (-80°C or liquid nitrogen).

    • Activity assays: Develop robust activity assays that can be performed at various stages of purification to track preservation of function.

By systematically optimizing these parameters, researchers can improve the yield and quality of recombinant PlsY for structural and functional studies.

How can researchers interpret contradictory data about PlsY function in S. oneidensis?

Interpreting contradictory data about PlsY function in S. oneidensis requires a multifaceted approach that considers biological complexity, experimental variability, and the possibility of novel discoveries:

  • Examine contextual factors:

    • Growth conditions: PlsY function may vary based on oxygen availability, temperature, pH, or nutrient status

    • Genetic background: Strain-specific variations might affect PlsY activity or regulation

    • Experimental systems: Compare results from in vitro biochemical assays versus in vivo cellular studies

    • Temporal aspects: Consider whether observations reflect transient versus steady-state phenomena

  • Reconcile contradictions through mechanistic hypotheses:

    • Multiple functions: PlsY might possess additional functions beyond its canonical acyltransferase activity

    • Regulatory complexity: The enzyme might be subject to complex post-translational modifications or allosteric regulation

    • Substrate availability: Variations in cellular acylphosphate pools could affect apparent activity

    • Protein-protein interactions: Associations with other cellular components might modulate function

  • Implement integrative analytical approaches:

    • Systems biology perspective: Analyze PlsY function within the broader context of cellular metabolism

    • Comparative genomics: Examine PlsY variations across Shewanella species to identify conserved versus variable features

    • Structural insights: Use homology modeling based on related acyltransferases to interpret functional data

    • Multi-omics integration: Combine transcriptomic, proteomic, and lipidomic data to develop comprehensive understanding

  • Design discriminatory experiments:

    • Develop experiments specifically designed to test competing hypotheses

    • Implement conditional PlsY expression systems to probe function under controlled conditions

    • Use site-directed mutagenesis to specifically target the three conserved motifs and assess their contributions to different aspects of function

    • Create chimeric proteins combining domains from different species to localize functional differences

When facing contradictory data, researchers should approach the situation with scientific rigor while maintaining an open mind, as unexpected findings often lead to new discoveries about enzyme function or regulation . The complex environmental adaptability of S. oneidensis, facilitated in part by its numerous mobile genetic elements , suggests that PlsY might display context-dependent functional variations that reflect the organism's remarkable metabolic flexibility.

What emerging technologies could advance our understanding of PlsY structure and function?

Several cutting-edge technologies hold promise for deepening our understanding of PlsY structure and function:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy: Could reveal the membrane-embedded structure of PlsY at near-atomic resolution, particularly important for visualizing the arrangement of transmembrane segments

    • Integrative structural biology: Combining computational modeling with experimental constraints from various techniques (crosslinking-mass spectrometry, EPR spectroscopy) to develop comprehensive structural models

    • Time-resolved crystallography: Could capture different conformational states during the catalytic cycle

  • Genomic and genetic engineering technologies:

    • CRISPR-Cas9 applications: Further refinement of genome editing in S. oneidensis beyond the W3 Beta recombinase system could enable precise manipulation of PlsY and interacting partners

    • Synthetic genomics: De novo synthesis of minimal S. oneidensis genomes with engineered PlsY variants to study essential functions

    • Directed evolution: Development of high-throughput screening systems for PlsY variants with enhanced properties for biotechnological applications

  • Advanced imaging and single-molecule techniques:

    • Super-resolution microscopy: To visualize PlsY localization and potential clustering in bacterial membranes

    • Single-molecule FRET: To study conformational dynamics during substrate binding and catalysis

    • Correlative light and electron microscopy: To connect PlsY localization with ultrastructural features

  • Systems biology and computational approaches:

    • Genome-scale metabolic modeling: To understand PlsY's role in the broader context of S. oneidensis metabolism

    • Molecular dynamics simulations: To model PlsY interactions with membrane lipids and substrates

    • Machine learning applications: To identify patterns in PlsY sequence-function relationships across bacterial species

By leveraging these emerging technologies, researchers can address fundamental questions about PlsY:

  • How does the enzyme coordinate with other components of phospholipid biosynthesis?

  • What conformational changes occur during the catalytic cycle?

  • How do membrane physical properties influence enzyme activity?

  • How has PlsY evolved across different Shewanella species to support their diverse ecological niches?

How might recombinant PlsY contribute to synthetic biology applications beyond bioremediation?

Recombinant PlsY has significant potential to contribute to diverse synthetic biology applications:

  • Designer membrane engineering:

    • Custom phospholipid compositions: Engineered PlsY variants with altered substrate specificity could produce membranes with novel properties

    • Bioelectronic interfaces: Tailored membranes could enhance electron transfer capabilities in bioelectronic devices

    • Biosensor development: Membranes with specific compositions could improve the sensitivity and selectivity of membrane-embedded biosensors

  • Bioproduction platforms:

    • Optimized cellular factories: Engineered PlsY could support membrane homeostasis in cells engineered to produce high-value compounds

    • Phospholipid derivative production: Modified PlsY could participate in enzymatic pathways for synthesizing specialty phospholipids with industrial or pharmaceutical applications

    • Extremophile-inspired applications: PlsY adaptations could support cellular function under industrial process conditions (high temperature, extreme pH)

  • Biomedical applications:

    • Antimicrobial strategies: PlsY is absent in mammals but essential in many bacteria, making it a potential target for novel antimicrobials

    • Drug delivery systems: Engineered bacterial membranes could serve as platforms for drug encapsulation and delivery

    • Diagnostic tools: PlsY-dependent phospholipid synthesis could be harnessed in diagnostic systems for detecting specific metabolites

  • Fundamental biological research:

    • Minimal cell development: Understanding the essential role of PlsY could inform the design of minimal synthetic cells

    • Membrane evolution studies: Engineered PlsY variants could serve as models to study membrane adaptation across diverse environments

    • Synthetic membrane biology: PlsY could be incorporated into artificial membrane systems to study basic principles of membrane biogenesis

The unique characteristics of S. oneidensis, particularly its electroactive properties and environmental adaptability , provide a distinctive foundation for these synthetic biology applications. By leveraging the bacterium's natural capabilities while engineering PlsY to introduce new functionalities, researchers could develop innovative biotechnological tools and platforms.

What are the most pressing unanswered questions about PlsY in S. oneidensis?

Several critical questions about PlsY in S. oneidensis remain unanswered, representing important areas for future research:

  • Structural and mechanistic questions:

    • What is the high-resolution structure of S. oneidensis PlsY, and how does it compare to PlsY from other bacteria?

    • How do the three conserved motifs coordinate substrate binding and catalysis in the context of the S. oneidensis membrane environment?

    • What are the rate-limiting steps in the catalytic cycle, and how might these be engineered for enhanced activity?

    • Are there S. oneidensis-specific regulatory mechanisms that modulate PlsY activity in response to environmental conditions?

  • Physiological role questions:

    • How does PlsY activity respond to the transition between aerobic and anaerobic respiration in S. oneidensis?

    • What membrane compositional changes mediated by PlsY occur during adaptation to metal-reducing conditions?

    • How does PlsY function interact with the extensive network of mobile genetic elements in S. oneidensis that facilitate rapid evolution?

    • Is PlsY activity coordinated with the expression and function of extracellular electron transfer components?

  • Evolutionary and comparative questions:

    • How has PlsY evolved across the Shewanella genus, and do differences correlate with species-specific metabolic capabilities?

    • Are there unique features of S. oneidensis PlsY compared to other bacterial acyltransferases that reflect its environmental niche?

    • Has horizontal gene transfer played a role in PlsY evolution in Shewanella species?

    • What selective pressures have shaped PlsY function in metal-reducing bacteria?

  • Biotechnological application questions:

    • Can PlsY be engineered to incorporate novel acyl chains that enhance membrane properties for specific applications?

    • How might PlsY modifications improve S. oneidensis performance in bioelectrochemical systems?

    • Could targeted PlsY engineering enhance the bacterium's bioremediation capabilities for specific contaminants?

    • What are the limits of PlsY plasticity for synthetic biology applications?

Addressing these questions will require integrative approaches combining structural biology, biochemistry, genetics, systems biology, and biotechnology. The answers will not only advance fundamental understanding of bacterial membrane biogenesis but could also enable novel applications leveraging the unique capabilities of S. oneidensis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.