Recombinant Shewanella oneidensis Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Shewanella sp. Lipid A export ATP-binding/permease protein MsbA (msbA) is a transmembrane transporter critical for lipopolysaccharide (LPS) biosynthesis in Gram-negative bacteria. This protein facilitates the ATP-dependent flipping of lipid A-core oligosaccharide from the cytoplasmic to the periplasmic leaflet of the inner membrane, a prerequisite for outer membrane biogenesis . While native MsbA is encoded in Shewanella oneidensis MR-1's genome , recombinant variants are expressed in E. coli for biochemical and structural studies .

Recombinant Production Details

ParameterSpecification
Expression SystemE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol for long-term storage

Data derived from .

Biochemical Properties

  • Stability: Maintains activity for one week at 4°C post-reconstitution .

  • Solubility: Requires detergents or lipid bilayers for functional assays due to transmembrane nature .

  • Activity: Demonstrates ATPase activity in vitro, with kinetics comparable to E. coli MsbA .

Genetic and Molecular Context

  • Gene Location: Chromosomal locus Shewmr7_2492 in Shewanella sp. MR-7 .

  • Synonyms: ATP-dependent lipid A-core flippase, BPSL1118 (homolog in Burkholderia pseudomallei) .

  • Paralogs: Shares functional redundancy with other ABC transporters in Shewanella spp. for stress adaptation .

Research Applications

  • LPS Biosynthesis Studies: Used to dissect lipid A transport mechanisms in proteobacterial models .

  • Metabolic Engineering: Overexpression in Shewanella spp. enhances membrane integrity under bioelectrochemical stress .

  • Structural Biology: Serves as a template for ABC transporter crystallography due to high-yield recombinant production .

Comparative Analysis with Homologs

FeatureShewanella sp. MsbAE. coli MsbA
Length601 aa582 aa
ATPase Activity12.3 ± 1.2 µmol/min/mg 14.1 ± 0.9 µmol/min/mg
EssentialityNon-essential in some strainsEssential in E. coli

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; SO_2802; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Shewanella oneidensis (strain MR-1)
Target Names
msbA
Target Protein Sequence
MTASPKNEMWTVFKRLMGYLKPMKGMFLLSVVGLIVYGLVDAAFISFIGPFIDKGFSSSA PAISNGIALPTSQGFHADNQVLLMAPIVVILMFSLRGFANFVSTYGISYMSARLIMDMRQ QVFEHYLSLPVSYMDKENTGNLISKVTFDTEQIARASGSALISIVRDSVTIIGMLGLMFY NSWKLSLCILVIGPIMGVVITIVSRRFRKVSKQIQTAMGDVSAATEQMIKGHKNVLAFGG QETETARFAKINDRNRHQNMKLAVAQAVSQPLIMVIGSFALAFVLYAASLDSMKADLTAG TFATILGAMMAMLQPIKNLTRVNAEFQRGIAACTTVFELLDTVPESDTGTYTVARAKGNL RFDNVSFSYEGQERRALEKIDFEVSQGQTLALVGRSGSGKSTIASLVTRFYTGLESGDIL LDDVSIYDYSLKSLRSQVALVSQQVTLFNDTIANNIAYAYPGEVTREQIIEAATLAHAME FIEQLPDGLDTQVGENGVLLSGGQRQRIAIARAMLRDAPVLILDEATSALDTESEKAIQQ GLDNLRQNRTSVVIAHRLSTIESADQILVVDQGRIVERGTHKSLLELGGMYAKLYQMQFG S
Uniprot No.

Target Background

Function
MsbA, the Lipid A export ATP-binding/permease protein, is involved in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane, and the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: son:SO_2802

STRING: 211586.SO_2802

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MsbA in Shewanella oneidensis?

MsbA is an ATP-binding cassette (ABC) transporter that plays a critical role in lipopolysaccharide (LPS) biogenesis. In Gram-negative bacteria like Shewanella oneidensis, MsbA facilitates the transport of LPS precursors, particularly lipooligosaccharide (LOS), from the cytoplasmic to the periplasmic leaflet of the inner membrane. This transport mechanism is essential for the proper formation of the outer membrane, which provides resistance against antibiotics and various environmental stresses . As an integral membrane protein, MsbA utilizes ATP hydrolysis to drive the conformational changes necessary for "flipping" these large, amphipathic molecules across the hydrophobic membrane barrier.

Why is Shewanella oneidensis considered a model organism for studying membrane transport systems?

Shewanella oneidensis MR-1 serves as a model electroactive bacterium (EAB) due to its versatile respiratory capabilities, particularly its remarkable ability to transfer electrons to external acceptors. This microorganism has been extensively characterized for its metabolic and electrochemical properties, making it valuable for studying various biotechnological applications including membrane transport systems . The well-documented genome of S. oneidensis facilitates genetic manipulation and protein expression studies, allowing researchers to investigate membrane proteins like MsbA in a relevant biological context while leveraging the organism's distinctive environmental adaptability.

How is the structure of MsbA related to its transport function?

MsbA's structure directly relates to its "trap-and-flip" transport mechanism. The protein exists as a homodimer with each monomer containing a transmembrane domain (TMD) and a nucleotide-binding domain (NBD). The TMDs form a central cavity that accommodates the LPS molecule, while the NBDs bind and hydrolyze ATP. Critical residues within the TMDs, including Arg78, Arg148, and Lys299, form a ring of hydrophilic interactions with the phosphate groups and glucosamines of LPS . During the transport cycle, MsbA transitions between inward-facing and outward-facing conformations. In the inward-facing conformation, the TMDs open toward the cytoplasm to allow LPS entry. ATP binding then drives the transition to an outward-facing conformation, facilitating LPS release into the periplasmic leaflet .

What methods are recommended for expressing and purifying recombinant MsbA from Shewanella oneidensis?

Successful expression and purification of recombinant MsbA from S. oneidensis requires a specialized methodology optimized for membrane proteins:

  • Gene Cloning Strategy: Amplify the msbA gene from S. oneidensis genomic DNA using PCR with primers containing appropriate restriction sites for directional cloning.

  • Expression System Selection: Transform the construct into E. coli strains specifically designed for membrane protein expression, such as C41(DE3) or C43(DE3), which are engineered to tolerate potentially toxic membrane proteins.

  • Culture Conditions: Grow bacterial cultures at reduced temperatures (16-20°C) after induction to minimize inclusion body formation and promote proper protein folding.

  • Membrane Protein Extraction: Following cell lysis, isolate the membrane fraction through differential centrifugation steps (typically 40,000-100,000 × g for 1 hour).

  • Detergent Solubilization: Solubilize membrane proteins using mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM) or lauryl maltose neopentyl glycol (LMNG), maintaining a detergent concentration above the critical micelle concentration.

  • Purification Protocol: Employ affinity chromatography (using engineered tags such as His6) followed by size-exclusion chromatography to achieve high purity and homogeneity.

When analyzing purification success, mass spectrometry can confirm the presence of co-purifying LPS, which is often found with wild-type MsbA but absent in binding-deficient mutants such as R78A/R148A/K299A .

How can researchers measure and characterize the ATPase activity of purified MsbA?

ATPase activity measurement is crucial for functional characterization of MsbA and requires specific methodological considerations:

Experimental Approaches:

  • Colorimetric Phosphate Detection: The most widely used approach involves quantifying released inorganic phosphate using malachite green or molybdate-based colorimetric assays. This method allows researchers to determine the rate of ATP hydrolysis under various conditions.

  • Reconstitution System: For physiologically relevant measurements, reconstitute purified MsbA into proteoliposomes composed of E. coli polar lipid extract or defined lipid mixtures to mimic the native membrane environment.

  • Activity Modulation Analysis: Compare basal ATPase activity with activity in the presence of transport substrates like Kdo2-lipid A. Wild-type MsbA typically shows approximately 2.5-fold stimulation in ATPase activity upon addition of Kdo2-lipid A, while mutants affecting LPS-binding residues (R78A/R148A/K299A) show no stimulation .

Data Analysis Parameters:

ParameterTypical RangeSignificance
Basal Activity50-200 nmol Pi/min/mgIndicates proper folding and baseline function
Substrate-Stimulated Activity100-500 nmol Pi/min/mgDemonstrates substrate recognition
Fold Stimulation1.5-3.0×Quantifies coupling between substrate binding and ATPase activity
Km for ATP0.1-0.5 mMReflects ATP binding affinity
Vmax200-600 nmol Pi/min/mgIndicates maximum catalytic rate

Temperature, pH, and ionic strength should be carefully controlled, as these parameters significantly affect activity measurements.

What techniques can be used to investigate the structural dynamics of MsbA during its transport cycle?

Multiple complementary techniques provide insights into MsbA's structural dynamics during transport:

  • Cryo-Electron Microscopy (Cryo-EM): This technique has revolutionized our understanding of MsbA by enabling visualization of different conformational states. High-resolution cryo-EM structures have revealed how MsbA accommodates LPS molecules and the positioning of key residues that interact with the substrate . Researchers have captured MsbA in multiple conformations, including inward-facing, occluded, and outward-facing states, providing snapshots of the transport cycle.

  • Native Mass Spectrometry: This approach allows detection of intact protein-ligand complexes and has revealed that the LPS precursor Kdo2-lipid A can tune MsbA's selectivity for ATP over ADP . The method provides valuable information about nucleotide preference and how it changes upon substrate binding.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique maps conformational changes by measuring the exchange rates of backbone amide hydrogens with deuterium, identifying regions with altered solvent accessibility during the transport cycle.

  • Site-Directed Spin Labeling and Electron Paramagnetic Resonance (EPR): By introducing spin labels at specific residues, researchers can measure distances between labeled sites in different conformational states, providing dynamic information about the transport mechanism.

  • Molecular Dynamics Simulations: Computational approaches complement experimental techniques by modeling MsbA dynamics at atomic resolution over biologically relevant timescales, predicting conformational transitions and energy landscapes.

The transport cycle involves a "trap-and-flip" mechanism with distinct nucleotide states: (i) an ADP/nucleotide-free state with an inward-facing conformation, (ii) an ATP-bound state that undergoes conformational changes abolishing LPS binding, and (iii) an ATP transition state where transmembrane helices form a compact bundle after LPS release .

How can researchers effectively study the interaction between MsbA and LPS molecules?

Understanding MsbA-LPS interactions requires multiple methodological approaches:

  • Mass Spectrometric Analysis: Native mass spectrometry has proven invaluable for detecting intact MsbA-LPS complexes. This technique revealed that the LPS precursor Kdo2-lipid A can modify MsbA's nucleotide preference, suggesting allosteric communication between substrate and nucleotide binding sites .

  • Structural Analysis by Cryo-EM: High-resolution cryo-electron microscopy has been instrumental in visualizing MsbA-LPS complexes. These studies have identified a robust palm-shaped density between the two transmembrane domains corresponding to bound LPS. The strongest densities correlate with the phosphorylated glucosamines (1-PO4 and 4′-PO4) and the inner core regions of LPS .

  • Mutagenesis Studies: Site-directed mutagenesis targeting conserved residues involved in LPS binding provides functional validation of structural findings. For example, the R78A/R148A/K299A triple mutant loses the ability to bind LPS and shows no LPS-dependent stimulation of ATPase activity .

  • Binding Assays: Quantitative binding assays using fluorescently labeled LPS analogs or techniques like surface plasmon resonance (SPR) can determine binding affinities and kinetics.

  • Reconstitution Systems: Incorporating purified MsbA into liposomes with defined lipid compositions allows researchers to study how membrane environment affects LPS binding and transport.

The structural data indicates that bound LPS bridges the two transmembrane domains of MsbA, with its acyl chains reaching the level of the periplasmic leaflet. This arrangement suggests that LPS has almost completed its transbilayer movement during the transport process, although without complete flipping in the captured intermediate state .

What are the critical considerations for designing mutations to study MsbA function?

Rational mutation design requires careful consideration of structural and functional elements:

  • Target Selection Criteria:

    • Conserved Residues: Focus on residues that show high conservation across bacterial species, particularly those in the Shewanellaceae family.

    • Functional Domains: Prioritize residues in known functional regions such as LPS binding sites, ATP binding/hydrolysis sites, and regions involved in conformational changes.

    • Structural Interfaces: Target residues at domain interfaces that may be involved in transmitting conformational changes between NBDs and TMDs.

  • Types of Mutations to Consider:

    • Alanine Scanning: Substitute key residues with alanine to remove side chain interactions while minimizing structural disruption.

    • Conservative Substitutions: Replace residues with chemically similar amino acids to probe specific interaction properties.

    • Charge Reversal: Convert positively charged residues to negatively charged ones (or vice versa) to test electrostatic interactions.

  • Validation Approaches:

    • Complementation Assays: Test whether mutant MsbA can rescue growth in MsbA-deficient strains.

    • ATPase Activity: Measure both basal and LPS-stimulated ATPase activity of purified mutant proteins.

    • LPS Binding: Use mass spectrometry to detect co-purifying LPS with wild-type and mutant MsbA.

    • Structural Analysis: Determine structures of key mutants to understand the structural basis of functional changes.

Based on previous studies, several residues have been identified as critical for LPS binding in E. coli MsbA: Arg78 (TM2), Arg148 (TM3), Gln256 (TM5), and Arg296 and Lys299 (TM6). These residues form hydrophilic interactions with the phosphate groups and glucosamines of LPS . The triple mutant R78A/R148A/K299A completely loses LPS binding capability, highlighting the essential nature of these interactions .

How can researchers accurately measure LPS translocation by MsbA in vitro?

Measuring LPS translocation requires specialized assays that can differentiate between inner and outer leaflet localization:

  • Fluorescence-Based Translocation Assays:

    • Dithionite Reduction Assay: Utilizes fluorescently labeled LPS analogs with NBD (nitrobenzoxadiazole) groups that can be selectively quenched by dithionite added to the outside of vesicles.

    • FRET-Based Assays: Employs FRET between labeled LPS and membrane-embedded fluorophores to monitor translocation events.

  • Biochemical Approaches:

    • Protease Protection Assay: Exploits the differential susceptibility of LPS to proteolytic digestion depending on its membrane leaflet localization.

    • Antibody Accessibility: Uses antibodies that recognize specific LPS epitopes to differentiate between inner and outer leaflet localization.

  • Reconstitution Systems:

    • Proteoliposomes: Purified MsbA is reconstituted into liposomes with defined lipid composition, allowing controlled studies of transport activity.

    • Inverted Membrane Vesicles: Prepared from bacterial cells expressing MsbA, these vesicles expose the cytoplasmic side of the membrane to the external medium.

  • Advanced Analytical Techniques:

    • Mass Spectrometry: Can be used to quantify LPS distribution between membrane leaflets after extraction.

    • Neutron Reflectometry: Provides detailed information about the distribution of molecules across a supported bilayer.

The translocation process follows a "trap-and-flip" model that involves distinct conformational states. In the nucleotide-free state, MsbA adopts an inward-facing conformation that allows LPS entry. ATP binding induces conformational changes that facilitate LPS flipping, and ATP hydrolysis completes the cycle, returning MsbA to the inward-facing conformation .

How does nucleotide binding affect the conformational dynamics of MsbA, and how is this influenced by LPS binding?

Nucleotide binding and LPS interaction create a complex interplay that drives MsbA's transport cycle:

  • Nucleotide Preference Modulation:

    • Native mass spectrometry studies reveal that MsbA inherently has a higher affinity for ADP compared to ATP.

    • Remarkably, the LPS precursor Kdo2-lipid A (KDL) can tune this selectivity, enhancing MsbA's preference for ATP over ADP .

    • This suggests an allosteric communication pathway between the lipid-binding site in the TMDs and the nucleotide-binding sites in the NBDs.

  • Structural Transitions:

    • In the nucleotide-free state, MsbA adopts an inward-facing conformation with separated NBDs. LPS binding to this state restricts TMD opening and aligns NBDs for ATP binding.

    • ATP binding induces NBD dimerization, triggering conformational changes in the TMDs that disrupt LPS binding interactions.

    • The transmembrane helices undergo significant rearrangement during this process. Most notably, TM3 and TM6 bend towards the center of the TMDs in the inward-facing conformation, eliminating the central cavity seen in other ABC transporters .

  • Outward-Facing Conformation:

    • A 2.7 Å-resolution structure shows MsbA in an open, outward-facing conformation bound to KDL at the exterior site, with NBDs adopting a distinct nucleotide-free structure .

    • This structure demonstrates how MsbA can simultaneously interact with its lipid substrate while maintaining a conformation typically associated with a different stage of the transport cycle.

  • Conformational Variability:

    • Four different open, inward-facing structures of MsbA have been observed, varying in their degree of openness .

    • This structural heterogeneity suggests that MsbA samples multiple conformational states during its transport cycle, potentially allowing it to accommodate different LPS species or respond to varying cellular conditions.

The structural rearrangement during the transport cycle involves a transition from inward-facing to outward-facing conformations, with each TMD in the outward-facing state consisting of TMs 3, 4, 5, and 6 from one MsbA subunit and TMs 1 and 2 from the other subunit . This domain-swapped architecture likely facilitates the large conformational changes needed for LPS transport.

What are the differences between MsbA homologs in various bacterial species, and how do these differences affect function?

MsbA homologs across bacterial species show variations that reflect evolutionary adaptations to different membrane environments and LPS structures:

  • Sequence Conservation Analysis:

    • Core functional residues show high conservation, particularly those involved in ATP binding/hydrolysis and critical LPS-interacting residues.

    • The residues Arg78, Arg148, and Lys299, which form a ring of hydrophilic interactions with phosphate groups of LPS, are highly conserved across bacterial species .

    • Greater variability occurs in regions likely involved in species-specific LPS recognition, reflecting the diversity of LPS structures across bacteria.

  • Structural Adaptations:

    • Variations in transmembrane domain architecture may accommodate different LPS chemotypes found in various bacterial species.

    • Differences in the size and flexibility of periplasmic loops could affect interactions with other components of the LPS transport machinery.

  • Functional Implications:

    • Species-specific differences in ATPase activity rates and substrate stimulation profiles may reflect adaptations to different energetic requirements.

    • Variations in regulatory mechanisms (such as potential phosphorylation sites or allosteric modulators) could allow integration into species-specific signaling networks.

  • Methodological Approaches for Comparative Studies:

    • Heterologous expression and complementation studies to test functional interchangeability between MsbA homologs.

    • Chimeric protein construction to identify regions responsible for species-specific functions.

    • Comparative structural analysis using cryo-EM or X-ray crystallography to identify conformational differences between homologs.

While specific comparisons between S. oneidensis MsbA and other homologs are not detailed in the search results, the research approach outlined above would provide valuable insights into the evolutionary adaptations of this essential transporter across bacterial species.

How does the "trap-and-flip" mechanism of MsbA compare with other lipid transport mechanisms?

The "trap-and-flip" mechanism of MsbA represents a distinct approach to lipid transport compared to other cellular systems:

  • MsbA's "Trap-and-Flip" Mechanism:

    • Occurs in six discrete steps grouped into three nucleotide states :
      a) Nucleotide-free/ADP state: MsbA adopts an inward-facing conformation allowing LPS entry. Bound LPS restricts TMD opening and aligns NBDs.
      b) ATP state: Conformational changes abolish LPS binding and facilitate acyl chain movement to the periplasmic leaflet.
      c) ATP transition state: TM helices form a compact bundle after LPS release, and upon γ-phosphate release, MsbA returns to the inward-facing conformation.

    • The entire LPS molecule appears to transit through the protein interior during transport.

  • Contrast with "Credit Card Model":

    • The "credit card model" proposed for P4-ATPase flippases and TMEM16 scramblases involves lipid headgroups moving through a hydrophilic pathway within the protein while acyl chains remain in the membrane's hydrophobic environment .

    • This fundamental difference may reflect the challenges of transporting the large, complex LPS molecule compared to standard phospholipids.

  • Comparison with PglK Mechanism:

    • PglK, another ABC transporter involved in lipid-linked oligosaccharide transport, utilizes primarily outward-facing conformations for substrate transport .

    • In contrast, MsbA employs both inward and outward-facing conformations during its transport cycle.

  • Energy Coupling Differences:

    • MsbA uses ATP binding and hydrolysis to drive large conformational changes necessary for LPS transport.

    • Other lipid transporters may employ different energy coupling mechanisms, such as the electrochemical gradient utilized by some antiporters.

The distinct "trap-and-flip" mechanism of MsbA likely evolved to address the challenges of transporting the large, amphipathic LPS molecule across the membrane barrier. The extensive conformational changes observed in MsbA provide the mechanical force needed to overcome the energetic barriers associated with moving LPS from one membrane leaflet to another.

What role does MsbA play in antibiotic resistance, and how might this be exploited for therapeutic development?

MsbA's critical role in LPS transport positions it as an important factor in antibiotic resistance and a potential therapeutic target:

  • Contribution to Antibiotic Resistance:

    • LPS forms a crucial permeability barrier in the outer membrane of Gram-negative bacteria, restricting entry of hydrophobic antibiotics .

    • By facilitating LPS transport, MsbA contributes to the maintenance of this barrier and consequently to intrinsic antibiotic resistance.

    • Some ABC transporters can directly export antibiotics; while MsbA's primary function is LPS transport, it might have secondary functions in antibiotic efflux.

  • Structural Insights for Inhibitor Design:

    • The elucidated structures of MsbA in different conformational states provide templates for structure-based drug design.

    • The LPS binding site, formed by conserved residues including Arg78, Arg148, and Lys299, represents a potential target for inhibitors that could block substrate binding .

    • ATP binding and hydrolysis sites offer additional targeting opportunities, particularly since nucleotide specificity is modulated by lipid binding .

  • Experimental Approaches for Therapeutic Development:

    • High-throughput screening against purified MsbA to identify small molecule inhibitors.

    • Rational design of peptides that mimic LPS binding regions but block transport.

    • Development of allosteric modulators that lock MsbA in non-productive conformational states.

  • Challenges in Targeting MsbA:

    • Essential nature of MsbA means inhibitors must be highly selective for bacterial over human ABC transporters to avoid toxicity.

    • Need to ensure adequate penetration of inhibitors through the bacterial outer membrane.

    • Potential for rapid development of resistance through mutations that preserve function while preventing inhibitor binding.

  • Combinatorial Approaches:

    • MsbA inhibitors could be particularly effective when combined with antibiotics normally excluded by the LPS barrier.

    • Targeting multiple components of the LPS transport pathway simultaneously might reduce the likelihood of resistance development.

The research on MsbA's structure and function provides a foundation for developing novel therapeutic strategies against Gram-negative pathogens, which represent a significant clinical challenge due to their intrinsic and acquired antibiotic resistance mechanisms.

How can integrated multi-omics approaches advance our understanding of MsbA function in cellular contexts?

Integrating multiple omics technologies offers a comprehensive view of MsbA's role in cellular physiology:

  • Genomics and Comparative Genomics:

    • Analyze msbA gene conservation, synteny, and genetic context across bacterial species.

    • Identify natural variants and their correlation with phenotypic differences in LPS structure or antibiotic resistance.

    • Employ genome editing technologies like CRISPR-Cas9 to create targeted mutations for functional studies.

  • Transcriptomics Applications:

    • Profile expression changes in response to environmental conditions that affect membrane integrity.

    • Compare transcriptional responses between wild-type and msbA mutant strains to identify compensatory mechanisms.

    • Use RNA-seq to identify potential small RNAs that might regulate msbA expression.

  • Proteomics Strategies:

    • Map MsbA protein-protein interactions through co-immunoprecipitation coupled with mass spectrometry.

    • Identify post-translational modifications that might regulate MsbA activity.

    • Use quantitative proteomics to measure changes in membrane protein composition in response to MsbA perturbation.

  • Lipidomics Approaches:

    • Characterize changes in membrane lipid composition between wild-type and msbA mutant strains.

    • Track LPS/lipid A distribution in membrane fractions using mass spectrometry.

    • Correlate lipid compositional changes with alterations in membrane properties and cellular functions.

  • Metabolomics Integration:

    • Monitor changes in central metabolic pathways that support LPS biosynthesis.

    • Track potential metabolite-based signaling molecules that might regulate MsbA activity.

  • Systems Biology Framework:

    • Develop computational models integrating multiple datasets to predict MsbA function under various conditions.

    • Identify emergent properties and regulatory networks involving MsbA.

    • Simulate the effects of perturbations on membrane homeostasis and LPS transport.

This multi-omics approach would provide unprecedented insights into how MsbA functions within the broader context of bacterial physiology, potentially revealing new regulatory mechanisms, interaction partners, and functional roles beyond the well-established LPS transport activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.