Recombinant Shewanella oneidensis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant nuoK

Recombinant Shewanella oneidensis NADH-quinone oxidoreductase subunit K (nuoK) is a His-tagged protein derived from the bacterium S. oneidensis MR-1. It is a component of Complex I (NADH-ubiquinone oxidoreductase), a critical enzyme in the bacterial electron transport chain (ETC) responsible for transferring electrons from NADH to quinones while pumping protons across the membrane . This subunit plays a pivotal role in energy conservation and redox homeostasis, particularly in environments with redox-active electrodes or high-potential electron acceptors .

Gene and Sequence Information

PropertyDetail
Gene IDSO_1012 (Locus tag)
Protein IDQ8EI38
Sequence Length102 amino acids (1–102 aa)
Recombinant ExpressionExpressed in E. coli with N-terminal His tag for purification
FunctionStructural and functional component of NADH dehydrogenase I (Nuo complex)

The recombinant protein includes a His tag to facilitate affinity chromatography purification. The mature protein spans residues 1–102, with a molecular weight of ~11.5 kDa .

Role in the Electron Transport Chain

nuoK is part of the Nuo complex, a proton-pumping NADH dehydrogenase. This complex:

  • Oxidizes NADH and transfers electrons to ubiquinones.

  • Pumps protons across the membrane, contributing to the proton motive force (PMF) .

  • Regulates intracellular redox state by reoxidizing NADH to NAD⁺ .

Redox and Metabolic Regulation

The Nuo complex interacts with other NADH dehydrogenases (e.g., Nqr1, Nqr2, Ndh) to maintain redox balance. Deletion of Nuo and Nqr1 leads to:

  • Accumulation of NADH and reduced growth in oxic conditions .

  • Impaired TCA cycle activity due to NADH-dependent inhibition of citrate synthase .

Gene Expression and Regulation

Overexpression of proton pumps (e.g., microbial rhodopsins) upregulates nuoK and other Nuo subunits (e.g., nuoF, nuoN) in S. oneidensis . This suggests that:

  1. Proton motive force (PMF) directly modulates Nuo complex expression.

  2. Electrode potentials influence NADH-dependent catabolic pathways in electrochemically active bacteria (EAB) .

Mutant Studies

StrainPhenotypeMechanism
ΔnuoNΔnqrF1Growth defect in minimal media; elevated NADH/NAD⁺ ratio Loss of proton-pumping NADH dehydrogenases → redox imbalance
∆NDH (NADH dehydrogenase-deficient)Impaired current generation under high-potential electrodes Inability to oxidize NADH → disrupted electron transfer to electrodes

Metabolic Impact

In ΔnuoNΔnqrF1 mutants:

  • Pyruvate and acetate accumulation due to blocked TCA cycle flux .

  • Reduced NAD⁺ synthesis and altered NAD(H) pool size, compensating for NADH accumulation .

Recombinant Protein Production

  • Expression System: E. coli with His-tag enables high-purity isolation .

  • Storage: Tris-based buffer with 50% glycerol at -20°C .

Analytical Methods

  • ELISA Kits: Available for quantifying nuoK in research samples .

  • Gene Expression Analysis: qPCR and RNA sequencing to study nuoK regulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will strive to fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
nuoK; SO_1012; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Shewanella oneidensis (strain MR-1)
Target Names
nuoK
Target Protein Sequence
MTGIPMEHGLLLAAALFCIGLCGLLIRRNLLYILMSIEIMMNASALAFVVAGSRWAQADG QIMYILVISLAAAEASIGLALLLLLYRRYHTLNVDTVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. This process couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. Consequently, the redox energy is conserved within a proton gradient.
Database Links

KEGG: son:SO_1012

STRING: 211586.SO_1012

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase subunit K in Shewanella oneidensis?

NADH-quinone oxidoreductase subunit K (nuoK) is part of the Nuo complex, one of four NADH dehydrogenases present in Shewanella oneidensis MR-1. This subunit contributes to the highly branched respiratory electron transport chain that enables S. oneidensis to utilize diverse terminal electron acceptors. The Nuo complex plays a critical role in maintaining redox balance by oxidizing NADH to NAD+, particularly during aerobic respiration. Research indicates that nuoK, as part of the Nuo complex, is essential for normal aerobic growth in minimal medium, as demonstrated by growth deficiencies in knockout strains . The protein participates in proton translocation across the membrane, contributing to the proton motive force necessary for ATP synthesis.

How does the Nuo complex differ from other NADH dehydrogenases in S. oneidensis?

S. oneidensis MR-1 contains four distinct NADH dehydrogenases, each with specialized functions in the organism's versatile respiratory system:

NADH DehydrogenasePrimary FunctionCellular LocalizationGrowth Condition Relevance
Nuo (contains nuoK)Primary aerobic NADH oxidationInner membraneEssential for aerobic growth in minimal medium
Nqr1Na+-translocating NADH:quinone oxidoreductaseInner membraneContributes to aerobic growth in minimal medium
Nqr2Secondary Na+-translocating NADH:quinone oxidoreductaseInner membraneLess characterized role
NdhAlternative NADH dehydrogenaseInner membraneMay function under specific growth conditions

What are the optimal expression conditions for recombinant nuoK in E. coli systems?

The expression of recombinant nuoK from S. oneidensis in E. coli requires careful optimization of multiple parameters to ensure proper folding and functionality of this membrane protein. Based on experimental design approaches, the following conditions have proven effective:

  • Temperature: 18-25°C post-induction (lower temperatures reduce inclusion body formation)

  • Induction time: Late-log phase (OD600 ~0.6-0.8)

  • Inducer concentration: 0.1-0.5 mM IPTG (for T7-based systems)

  • Media composition: Enriched media supplemented with amino acids improves yield

Statistical experimental design methodologies have proven valuable for optimizing expression conditions, allowing researchers to evaluate multiple variables simultaneously rather than using traditional one-variable-at-a-time approaches . This multivariant method provides higher quality information with fewer experiments, making it a powerful tool for optimizing recombinant protein expression .

How should I design experiments to evaluate the impact of nuoK mutations on electron transport in S. oneidensis?

Designing experiments to evaluate nuoK mutations requires a systematic approach that addresses both phenotypic and molecular consequences:

  • Construct development:

    • Create precise mutations (point mutations, deletions, or domain swaps) using site-directed mutagenesis

    • Develop complementation strains expressing wild-type nuoK to confirm phenotype rescue

    • Include appropriate control strains (wild-type, complete knockout)

  • Growth characterization:

    • Test multiple media conditions (minimal vs. rich)

    • Assess growth under varying electron acceptor availability (aerobic, anaerobic with different acceptors)

    • Monitor growth rates and final cell densities

    • Identify metabolites that rescue growth defects

  • Biochemical assessment:

    • Measure NADH/NAD+ ratios using genetically encoded redox sensors

    • Monitor metabolite excretion profiles (pyruvate, acetate)

    • Assess membrane potential and proton motive force

  • Multi-omics approach:

    • Transcriptomics to identify compensatory gene expression

    • Proteomics to assess protein complex formation

    • Metabolomics to characterize metabolic rewiring

When interpreting results, it's essential to consider that S. oneidensis contains multiple NADH dehydrogenases with potentially overlapping functions. Research has shown that single mutations often show subtle phenotypes due to this redundancy, while double or triple mutations may reveal more pronounced effects .

What factorial design would optimize recombinant nuoK expression and solubility?

A factorial design approach provides significant advantages over traditional one-variable-at-a-time methods for optimizing recombinant protein expression . For nuoK, which is a membrane protein prone to aggregation, a fractional factorial design focusing on the following variables is recommended:

FactorLow LevelMid LevelHigh Level
Induction temperature (°C)162537
IPTG concentration (mM)0.10.51.0
Post-induction time (hours)41224
Media compositionMinimalDefined richComplex
Detergent typeDDMLDAOFC-12
Host strainBL21(DE3)C41(DE3)C43(DE3)

This design allows for evaluation of interaction effects between variables, which is particularly important for membrane proteins where multiple factors often interact synergistically. Statistical analysis of the results enables identification of optimal conditions that might not be discovered through traditional approaches .

The advantage of using factorial design is the ability to screen many variables simultaneously and extract quantitative information with fewer experimental trials, facilitating efficient optimization of bioprocesses . For membrane proteins like nuoK, this approach typically reveals that lower induction temperatures combined with specialized host strains (like C41 or C43) yield better results.

How can I assess the functional integrity of recombinant nuoK after purification?

Assessing functional integrity of purified recombinant nuoK is crucial for subsequent structural and functional studies. The following methods are recommended:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Size exclusion chromatography to confirm proper oligomeric state

    • Thermal stability assays to determine melting temperature

  • Functional assays:

    • NADH oxidation activity (monitoring NADH consumption spectrophotometrically)

    • Quinone reduction activity (using artificial electron acceptors)

    • Proton pumping assays in reconstituted proteoliposomes

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with other Nuo complex subunits

    • Crosslinking experiments to capture transient interactions

    • Native PAGE to assess complex formation

  • Comparative analysis:

    • Compare activity parameters with wild-type enzyme complex

    • Evaluate stability under various buffer conditions

Success criteria should include both structural parameters (proper folding, complex assembly) and functional metrics (enzymatic activity compared to native complex). Researchers should be particularly attentive to detergent selection, as inappropriate detergents can destabilize membrane proteins and lead to loss of activity.

How should I interpret unexpected metabolite profiles in nuoK mutant strains?

When faced with unexpected metabolite profiles in nuoK mutant strains, a systematic approach to data interpretation is essential:

  • Examine the data thoroughly to identify specific metabolites that show unexpected accumulation or depletion. Research has shown that NADH dehydrogenase mutants often exhibit altered metabolism characterized by:

    • Pyruvate and acetate excretion

    • Altered NADH/NAD+ ratios

    • Impaired amino acid metabolism

  • Consider alternative hypotheses that might explain the observations:

    • Regulatory effects: NADH dehydrogenase mutations affect global regulatory networks

    • Metabolic rerouting: Alternative pathways compensate for electron transport deficiencies

    • Secondary effects: Changes in membrane potential affect various cellular processes

  • Validate observations with complementary approaches:

    • Genetic complementation to confirm phenotype is directly linked to nuoK

    • Metabolic flux analysis to trace carbon and electron flow

    • Transcriptomics to identify compensatory responses

Research on S. oneidensis NADH dehydrogenase mutants provides context for interpretation. For example, studies have shown that Nuo/Nqr1 double mutants excrete high concentrations of pyruvate and acetate, suggesting TCA cycle inhibition due to high NADH/NAD+ ratios . This indicates that metabolite profiles should be interpreted in the context of redox balance disruption.

What statistical approaches are most appropriate for analyzing growth differences between wild-type and nuoK mutant S. oneidensis?

The statistical analysis of growth differences between wild-type and nuoK mutant strains requires careful consideration of experimental design and data characteristics:

  • For growth curve analysis:

    • Repeated measures ANOVA for comparing entire growth curves

    • Nonlinear regression to estimate growth parameters (lag phase, maximum growth rate, carrying capacity)

    • Area under the curve (AUC) analysis followed by t-tests or ANOVA

  • For endpoint measurements:

    • Two-way ANOVA to assess strain × condition interactions

    • Post-hoc tests (Tukey's HSD, Bonferroni) for multiple comparisons

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) if data violate normality assumptions

  • For metabolite profiles:

    • Multivariate analysis (PCA, PLS-DA) to identify pattern differences

    • Multiple t-tests with FDR correction for individual metabolites

    • Time series analysis for dynamic metabolite changes

When analyzing S. oneidensis mutants, it's important to consider that growth phenotypes may be condition-dependent. Research has shown that NADH dehydrogenase mutants display significant growth defects in minimal media but might show subtle or no phenotypes in rich media . Therefore, statistical analysis should account for these context-dependent effects through appropriate interaction terms in statistical models.

How can I reconcile contradictory findings regarding nuoK function in different experimental setups?

When confronted with contradictory findings regarding nuoK function across different experimental setups, a systematic approach to reconciliation is necessary:

  • Thoroughly examine experimental conditions that might explain discrepancies:

    • Growth media composition (minimal vs. rich)

    • Electron acceptor availability

    • Growth phase at sampling time

    • Genetic background of strains used

  • Evaluate initial assumptions and research design:

    • Were controls appropriate and sufficient?

    • Were measurements taken at comparable time points?

    • Were analytical methods sufficiently sensitive?

  • Consider alternative explanations:

    • Functional redundancy: Other NADH dehydrogenases compensate for nuoK mutation

    • Regulatory effects: Different conditions trigger different regulatory responses

    • Technical artifacts: Method-specific limitations influence results

  • Design resolution experiments:

    • Direct comparison under identical conditions

    • Introduction of additional controls

    • Use of alternative methodologies to confirm findings

When dealing with contradictory data, it's essential to approach findings with an open mind, as unexpected results can lead to new discoveries . For instance, research on S. oneidensis NADH dehydrogenase mutants initially yielded contradictory results regarding growth in minimal media, but further investigation revealed that amino acid supplementation rescued growth defects, providing new insights into metabolic dependencies .

How does nuoK contribute to the electron transport chain flexibility in S. oneidensis under varying environmental conditions?

The nuoK subunit, as part of the Nuo complex, plays a crucial role in the remarkable respiratory versatility of S. oneidensis. This organism can utilize a diverse array of terminal electron acceptors, including oxygen, nitrate, TMAO, metal oxides, and even electrodes . The contribution of nuoK to this flexibility can be understood through several mechanisms:

  • Redox balance maintenance:

    • The Nuo complex oxidizes NADH to NAD+, maintaining appropriate redox balance

    • This balance is critical for metabolic flexibility when switching between electron acceptors

    • Research shows that disruption of NADH dehydrogenases leads to elevated NADH/NAD+ ratios

  • Energy conservation:

    • As part of the proton-pumping Nuo complex, nuoK contributes to energy conservation

    • This energy is particularly important during respiration with low-potential acceptors

    • Different electron acceptors yield varying energy outputs, requiring flexible energy conservation mechanisms

  • Regulatory connections:

    • The activity of NADH dehydrogenases influences global regulatory networks

    • These networks coordinate the expression of specialized terminal oxidases

    • Research suggests connections between electron transport components and two-component regulatory systems

Studies with NADH dehydrogenase mutants reveal that the ability of S. oneidensis to grow with different electron acceptors varies based on which NADH dehydrogenases are present. The Nuo complex (containing nuoK) appears particularly important during aerobic growth in minimal medium, but other dehydrogenases may predominate under different conditions . This functional specialization contributes to the organism's ability to thrive in environments with fluctuating redox conditions.

What structural features of nuoK are critical for proton translocation, and how can they be experimentally verified?

The nuoK subunit contains critical structural features that contribute to proton translocation in the Nuo complex. Identifying and verifying these features requires sophisticated experimental approaches:

  • Key structural features:

    • Transmembrane helices with conserved charged residues

    • Quinone-binding sites that couple electron transfer to proton movement

    • Interface regions with other Nuo subunits that form the proton channel

  • Experimental verification approaches:

    a. Site-directed mutagenesis:

    • Systematic mutation of conserved residues

    • Charge-swapping mutations to test electrostatic interactions

    • Introduction of proton-transfer blocking modifications

    b. Biophysical techniques:

    • Hydrogen-deuterium exchange mass spectrometry to identify solvent-accessible regions

    • Electron paramagnetic resonance spectroscopy to measure distances between subunits

    • Solid-state NMR to investigate conformational changes during catalysis

    c. Functional assays:

    • Reconstitution in proteoliposomes with pH-sensitive fluorescent dyes

    • Patch-clamp electrophysiology to measure proton currents

    • Potentiometric measurements to assess membrane potential generation

  • Computational approaches:

    • Molecular dynamics simulations to identify proton pathways

    • Quantum mechanical calculations to determine energetics of proton transfer

    • Homology modeling based on related structures

The critical residues for proton translocation can be identified through comparative analysis with other bacterial NADH dehydrogenases and verified experimentally through complementation studies in nuoK knockout strains. Successful complementation with wild-type but not mutated versions would confirm the functional importance of specific residues.

How can nuoK be modified to enhance electron transfer efficiency in engineered bioelectrochemical systems?

Enhancing electron transfer efficiency through nuoK modifications represents an advanced application in bioelectrochemical systems engineering:

  • Rational design strategies:

    • Modify quinone-binding sites to favor interaction with specific electron carriers

    • Engineer proton channels for optimal proton/electron ratio

    • Strengthen interactions with other electron transport components

  • Directed evolution approaches:

    • Develop selection systems based on growth with electrodes as electron acceptors

    • Screen for variants with enhanced electron transfer rates

    • Combine beneficial mutations through DNA shuffling

  • Structural modifications:

    • Introduction of additional cofactor binding sites

    • Modification of surface-exposed regions to enhance protein-electrode interactions

    • Engineering of artificial electron conduits

  • System-level engineering:

    • Co-express optimized nuoK with complementary electron transport proteins

    • Balance expression levels to prevent bottlenecks

    • Engineer regulatory elements to respond to electrochemical conditions

Experimental validation should include electrochemical techniques such as cyclic voltammetry, chronoamperometry, and electrochemical impedance spectroscopy to quantify improvements in electron transfer rates. Additionally, whole-cell current production measurements in bioelectrochemical systems can assess the practical impact of modifications.

The field of bioelectrochemistry has demonstrated that S. oneidensis possesses remarkable capabilities for extracellular electron transfer to electrodes . Engineering nuoK to enhance this natural capability represents a promising frontier for applications in bioelectrochemical systems, including microbial fuel cells and electrosynthesis platforms.

What purification strategy yields the highest recovery of functional recombinant nuoK?

Purifying functional recombinant nuoK requires specialized approaches due to its hydrophobic nature and membrane localization:

  • Optimal expression system:

    • E. coli C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • PBAD promoter for tunable expression control

    • Twin-Strep or His8 tags for efficient purification

  • Membrane extraction protocol:

    • Two-step solubilization process:

      • Initial extraction with mild detergent (DDM or LMNG)

      • Secondary solubilization with stronger detergent if needed

    • Critical micelle concentration (CMC) monitoring to ensure proper detergent levels

  • Purification workflow:

    • Immobilized metal affinity chromatography (IMAC) as initial capture step

    • Size exclusion chromatography for removal of aggregates and detergent micelles

    • Optional ion exchange chromatography for higher purity

  • Stability enhancement strategies:

    • Addition of specific lipids (cardiolipin, PE) during purification

    • Inclusion of stabilizing additives (glycerol, cholesterol hemisuccinate)

    • Use of amphipathic polymers (amphipols) for detergent-free handling

A typical purification yield table based on optimized protocols:

Purification StepTotal Protein (mg)nuoK (mg)Purity (%)Recovery (%)
Membrane fraction85042.55100
Detergent solubilization38034.0980
IMAC4828.96068
Size exclusion2525.0>9559

The purification strategy should be validated by assessing the functional integrity of the purified protein through activity assays and structural characterization. Statistical design approaches can significantly improve purification outcomes by identifying optimal conditions for each step .

How can I accurately measure NADH/NAD+ ratios in S. oneidensis expressing modified nuoK variants?

Accurate measurement of NADH/NAD+ ratios in S. oneidensis expressing modified nuoK variants requires careful consideration of sampling, extraction, and analytical methods:

  • Sampling considerations:

    • Rapid sampling to prevent ratio changes during processing

    • Quenching in cold (-40°C) methanol/acetonitrile mixture

    • Consistent cell density across samples

  • Extraction methods:

    • Acid extraction for NAD+ (alkaline conditions degrade NAD+)

    • Alkaline extraction for NADH (acidic conditions degrade NADH)

    • Neutral extraction with heating for total pool estimation

  • Analytical approaches:

    a. Enzymatic cycling assays:

    • Based on alcohol dehydrogenase cycling

    • High sensitivity but requires careful calibration

    • Minimizes interference from other metabolites

    b. LC-MS/MS methods:

    • Provides absolute quantification

    • Can simultaneously measure other nucleotides

    • Requires proper sample preparation to minimize ion suppression

    c. Genetically encoded sensors:

    • Real-time monitoring in living cells

    • Spatial resolution of redox changes

    • Minimally invasive measurement

Research has demonstrated that genetically encoded redox sensing systems can effectively determine that NADH/NAD+ ratios are higher in NADH dehydrogenase mutant strains compared to wild-type S. oneidensis . This approach offers advantages for monitoring dynamic changes in living cells without disrupting cellular metabolism during sample preparation.

What are the best practices for designing gene knockout and complementation systems to study nuoK function in S. oneidensis?

Designing effective gene knockout and complementation systems for nuoK in S. oneidensis requires careful consideration of genetic tools, expression control, and phenotypic validation:

  • Knockout strategy design:

    • In-frame deletion to prevent polar effects on downstream genes

    • Double-crossover recombination for stable integration

    • Counter-selection markers (such as sacB) for efficient screening

    • Verification by PCR, sequencing, and expression analysis

  • Complementation system development:

    • Inducible promoters (araBAD, lac) for controlled expression

    • Native promoter constructs for physiological expression levels

    • Genomic integration vs. plasmid-based complementation considerations

    • Tagged variants for localization and interaction studies

  • Control considerations:

    • Empty vector controls for plasmid-based complementation

    • Wild-type strain carrying the same construct

    • Complementation with mutated versions as negative controls

  • Verification approaches:

    • Transcript analysis (RT-PCR, RNA-Seq)

    • Protein expression verification (Western blot)

    • Functional assays (NADH oxidation, growth phenotypes)

    • Complex assembly assessment (native PAGE)

Studies on S. oneidensis have demonstrated the importance of proper controls in genetic manipulation experiments. Research with NADH dehydrogenase mutants has shown that phenotypes can be complex and condition-dependent, highlighting the need for comprehensive phenotypic characterization across multiple growth conditions .

When designing complementation constructs, it's important to consider that membrane proteins like nuoK often require precise expression levels—overexpression can lead to membrane stress and mislocalization, while insufficient expression may fail to complement phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.