Recombinant Shewanella oneidensis Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Physicochemical Properties

The recombinant UbiB protein exhibits several important physicochemical properties that influence its handling and experimental applications:

PropertyDescription
Source OrganismShewanella oneidensis
Expression SystemE. coli
TagN-terminal His-tag
Protein LengthFull Length (1-549 amino acids)
FormLyophilized powder
PurityGreater than 90% (SDS-PAGE determined)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C/-80°C (avoid repeated freeze-thaw cycles)
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL) with 5-50% glycerol

Table 1: Physicochemical properties of recombinant S. oneidensis UbiB protein

Functional Role in Ubiquinone Biosynthesis Pathway

The ubiquinone (coenzyme Q or UQ) biosynthetic pathway involves multiple proteins working in concert to convert precursor molecules into the final functional ubiquinone molecule. In bacteria such as E. coli, this pathway has been extensively studied, revealing nine proteins (UbiA-UbiH, UbiX) directly involved in the biosynthetic process . Recent research has expanded this understanding to include additional proteins such as UbiJ, UbiK, UbiT, UbiU, and UbiV, which play supporting roles in the pathway .

Proposed Mechanism of UbiB Action

Based on recent research findings, UbiB appears to play a crucial role in the extrusion of ubiquinone intermediates from the plasma membrane. Specifically, UbiB has been postulated to facilitate the extraction of 3-octaprenyl-4-hydroxybenzoate (HBOT) from the membrane, allowing for subsequent decarboxylation by UbiD-X to form 2-octaprenyl phenol (OPP) . This function is critical for the progression of the ubiquinone biosynthetic pathway, as it enables the transition of intermediates between membrane-bound and cytosolic enzymatic processing steps.

The mechanism by which UbiB performs this function is believed to involve ATP hydrolysis. This hypothesis is supported by studies on Coq8, the eukaryotic homolog of UbiB, which has been postulated to couple ATP hydrolysis to the extrusion of the polar heads of ubiquinone intermediates from the membrane . This energy-dependent process enables the otherwise membrane-bound intermediates to be accessed by soluble enzymes in the biosynthetic pathway.

Position in the Ubiquinone Biosynthetic Complex

An interesting aspect of UbiB's function is its position relative to the multi-protein complex (metabolon) that carries out ubiquinone biosynthesis. Unlike many other Ubi proteins that form a stable complex, UbiB does not appear to be part of this metabolon . Instead, UbiB acts independently at the interface between the membrane and the Ubi complex, facilitating the transfer of intermediates between these two domains.

The current model suggests that UbiB extracts HBOT from the membrane, after which OPP (formed by decarboxylation) associates with UbiJ within the Ubi complex . This arrangement allows for the coordinated progression of the biosynthetic pathway, with UbiB playing a critical role in the early stages of intermediate processing.

Experimental Applications and Research Methodologies

The recombinant form of S. oneidensis UbiB protein serves as a valuable tool for various biochemical and structural studies of ubiquinone biosynthesis. The ability to produce and purify this protein in substantial quantities facilitates detailed investigations of its structure, function, and interactions.

Recombinant Expression and Purification

The recombinant UbiB protein is typically expressed in E. coli systems, which provide an efficient platform for the production of the full-length protein . The inclusion of an N-terminal His-tag enables purification through affinity chromatography, yielding protein preparations with greater than 90% purity as determined by SDS-PAGE analysis .

For optimal stability and functionality, the purified protein is typically stored as a lyophilized powder or in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . Reconstitution protocols recommend dissolving the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of glycerol (5-50% final concentration) for long-term storage at -20°C/-80°C .

Integration with S. oneidensis Research

Shewanella oneidensis MR-1 has attracted significant research interest due to its remarkable ability to reduce a diverse array of substrates and its potential applications in bioelectrochemical systems . Recent advances in genetic code expansion in S. oneidensis MR-1 have enabled the site-specific incorporation of noncanonical amino acids into proteins, expanding the toolbox for investigating protein function and interactions .

While these genetic engineering approaches have not been specifically reported for UbiB in the available search results, they represent promising avenues for future research to probe the structure-function relationships of UbiB in ubiquinone biosynthesis. Such approaches could potentially allow for the selective labeling or modification of key residues in UbiB to investigate its membrane interaction, ATP hydrolysis, or substrate binding properties.

Relationship to Ubiquinone Biosynthesis in Context

Ubiquinone biosynthesis represents a complex pathway with significant implications for cellular energetics and redox balance. The pathway involves multiple enzymatic steps and protein-protein interactions, with UbiB playing a specialized role in intermediate trafficking.

The Ubi Complex and Metabolon Formation

Recent research has established that many of the proteins involved in ubiquinone biosynthesis in E. coli form a stable multi-protein complex, or metabolon, that facilitates the efficient channeling of intermediates through the pathway . This complex includes seven Ubi proteins (encircled in red in the original research figure) that work together to convert OPP into the final ubiquinone product (UQ8 in E. coli) .

Interestingly, UbiB stands apart from this core complex, functioning independently at the membrane interface. This arrangement suggests a specialized role for UbiB in bridging the membrane-bound and cytosolic phases of ubiquinone biosynthesis .

Model of UbiB Function in the Pathway

Based on the available research, a model of UbiB function can be proposed:

  1. UbiB, with its transmembrane domain, associates with the plasma membrane where early ubiquinone intermediates reside

  2. Through an ATP-dependent mechanism, UbiB facilitates the extraction of HBOT from the membrane

  3. HBOT is then decarboxylated by UbiD-X to form OPP

  4. OPP is bound by UbiJ within the Ubi complex, where it undergoes further modifications

  5. The final ubiquinone product (UQ8) is delivered back to the membrane for its physiological functions

This model highlights the critical role of UbiB in initiating the cytosolic phase of ubiquinone biosynthesis, enabling the subsequent enzymatic modifications that lead to the final functional product.

Comparative Analysis with Homologs

Understanding the relationship between UbiB and its homologs in other organisms provides valuable insights into its evolutionary conservation and functional significance.

Comparison with Eukaryotic Homolog Coq8

As mentioned previously, UbiB shares homology with the eukaryotic protein Coq8, which is also involved in ubiquinone biosynthesis . Both proteins appear to perform similar functions in facilitating the extraction of intermediates from the membrane, suggesting a conserved mechanism for this critical step in the pathway.

The functional parallel between UbiB and Coq8, particularly regarding ATP-dependent extraction of ubiquinone intermediates, points to the evolutionary conservation of this mechanism across diverse organisms . This conservation underscores the critical nature of this function for efficient ubiquinone biosynthesis.

Future Research Directions and Applications

The study of recombinant S. oneidensis UbiB presents several promising avenues for future research, both in terms of fundamental understanding and potential applications.

Mechanistic Investigations

Further biochemical studies are needed to confirm and characterize the proposed ATP-dependent mechanism of UbiB. Such investigations could explore the kinetics of ATP hydrolysis, the specificity for different ubiquinone intermediates, and the structural changes that accompany the extraction process.

Integration with S. oneidensis Biotechnology

The emerging field of S. oneidensis biotechnology, particularly its applications in bioelectrochemical systems, presents interesting possibilities for leveraging the function of UbiB . Given the importance of ubiquinone in electron transport chains, understanding and potentially modifying UbiB function could have implications for optimizing electron transfer processes in engineered S. oneidensis systems.

Therapeutic Relevance

While not directly addressed in the available search results, understanding ubiquinone biosynthesis has potential therapeutic implications. Ubiquinone deficiencies are associated with various human diseases, and insights from bacterial systems could potentially inform approaches to address these conditions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiB; SO_4201; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-549
Protein Length
full length protein
Species
Shewanella oneidensis (strain MR-1)
Target Names
ubiB
Target Protein Sequence
MTLASIRRGYHVIKTLLQYGLDDVLPPKMTPWYFTLARNSLFWIRNKHKDKSGGERLKLA MQELGPVYIKLGQMLSTRRDLLSDEWATELAMLQDKVPPFDGALARLAIEAELKAPIETF FDDFNETPLASASISQVHTATLKSNGKAVVLKVLRPNVETKIQADLLLMSQTAKVIDYLL GEGNRLRPAEVIEDYRVTILGELNLKLEALNAIKLRNNFIDSDALYIPYVYEEFCYPRLM VMERIYGIPVSDIVALKAQGTNFKLLAERGVELFFTQVFRDNFFHADMHPGNIFISRENP ENPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIAQLYIESGWVSEKTDLQAFEQ AIKVVCEPMFNKPLDEISFGHVLLELFRTARHFDIVVQPQLVLLEKTLLYIEGLGRQLYP QLDLWQTAKPFLEQWMAEQVGPKAMFKKVSTKLPYWSDKLPEFPELIYDNLKLGRKLLSS QQQMLDKYLKYQQQAHKSNYLLITSAILLICGTLLFNQDATLLSPYVCLISGAVLWIIGW RSRPKNRKF
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links

KEGG: son:SO_4201

STRING: 211586.SO_4201

Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shewanella oneidensis MR-1 and why is it significant for studying UbiB protein?

Shewanella oneidensis MR-1 is an aquatic, facultative anaerobic bacterium with extraordinary respiratory versatility, capable of utilizing a wide range of electron acceptors including oxygen, metals like Cr(VI), electrodes, and solvents such as dimethyl sulfoxide (DMSO). This respiratory diversity makes it an invaluable model organism for studying bioremediation of toxic and radioactive metals and for understanding extracellular electron transfer mechanisms . The bacterium shows great potential for environmental pollutant remediation and electrical current generation in applications like wastewater treatment .

Studying UbiB protein in S. oneidensis is particularly significant because of its probable role in ubiquinone biosynthesis. Ubiquinone (coenzyme Q) is a critical component of the electron transport chain that facilitates electron flow across the cellular membrane. Given S. oneidensis' diverse respiratory pathways and remarkable ability to transfer electrons to external acceptors, understanding UbiB's function provides crucial insights into how this bacterium maintains efficient energy metabolism under varying environmental conditions . The protein's role becomes even more significant considering that S. oneidensis forms nanowires (outer membrane extensions containing specialized cytochromes) under electron acceptor-limited conditions, a process that requires coordinated regulation of various electron transport components .

What is the structure and basic function of UbiB protein in Shewanella oneidensis?

The UbiB protein in Shewanella oneidensis is a full-length 549-amino acid protein encoded by the ubiB gene (locus SO_4201). Its amino acid sequence begins with MTLASIRRGYHVIKTLLQ and contains various functional domains typical of the UbiB protein family . The complete amino acid sequence reveals a complex protein structure that likely supports its enzymatic function in the ubiquinone biosynthetic pathway .

Functionally, UbiB is classified as a probable ubiquinone biosynthesis protein, suggesting its involvement in the production pathway of ubiquinone (coenzyme Q) . In bacteria, ubiquinone serves as an essential lipid-soluble electron carrier in the respiratory chain, facilitating electron transfer between various protein complexes. The protein is also described as a "probable protein kinase UbiB" in some annotations, indicating it likely functions as a kinase in the ubiquinone biosynthesis pathway . This enzymatic role would involve phosphorylation of substrate proteins or metabolic intermediates, a critical step in the complex multi-enzyme process of ubiquinone production. In S. oneidensis specifically, UbiB's function is particularly important given the organism's diverse respiratory capabilities and its need to maintain efficient electron transfer under varying environmental conditions .

How is recombinant UbiB protein typically expressed and purified for research purposes?

Recombinant Shewanella oneidensis UbiB protein is typically expressed using heterologous expression systems, with Escherichia coli being the preferred host organism. The gene encoding UbiB (ubiB) is cloned into an expression vector that incorporates an affinity tag, most commonly a His-tag (polyhistidine tag) at the N-terminus to facilitate purification . This expression strategy has been successfully implemented to produce functional UbiB protein for research applications.

For expression, the recombinant plasmid containing the ubiB gene is transformed into E. coli, and protein production is induced under controlled conditions . After sufficient growth and protein expression, cells are harvested and lysed to release the recombinant protein. The His-tagged UbiB protein is then purified from the cell lysate using immobilized metal affinity chromatography, typically with Ni-NTA resin that selectively binds to the His-tag . Following purification, the protein is often stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability .

How does UbiB function differ in aerobic versus anaerobic conditions in Shewanella oneidensis?

The function of UbiB protein in Shewanella oneidensis likely exhibits significant differences between aerobic and anaerobic conditions, reflecting the bacterium's remarkable respiratory versatility. Under aerobic conditions, UbiB primarily supports the canonical ubiquinone biosynthesis pathway essential for aerobic respiration, where oxygen serves as the terminal electron acceptor in the electron transport chain .

In contrast, under anaerobic conditions when S. oneidensis switches to alternative electron acceptors such as metals, electrodes, or solvents like DMSO, UbiB's role likely adapts to support these alternative respiratory pathways . RNA-Seq analysis of S. oneidensis under oxygen-limited conditions has revealed coordinated increased expression of heme biosynthesis, cytochrome maturation, and transport pathways, indicating that the bacterium increases cytochrome production during electron acceptor limitation . This includes upregulation of genes encoding specialized cytochromes like MtrA, MtrC, and OmcA that are essential for extracellular electron transfer .

While the search results don't provide direct evidence for changes in ubiB expression under different respiratory conditions, its function in ubiquinone biosynthesis would need to adapt to these changing respiratory requirements. The electron transport chain components, including ubiquinone, must accommodate electron flow to diverse acceptors under anaerobic conditions, suggesting that UbiB's activity might be integrated with the expression of specialized cytochromes involved in extracellular electron transfer . Interestingly, the expression of certain homologous genes (like mtrF and mtrD) remains unaffected or decreases under oxygen limitation, suggesting a functional specialization of different components of the electron transport machinery under various respiratory conditions .

What techniques are most effective for studying UbiB protein interactions with other components of the electron transport chain?

Studying UbiB protein interactions with other components of the electron transport chain in Shewanella oneidensis requires a multifaceted approach combining in vivo and in vitro techniques. Several methodologies have proven particularly effective for investigating membrane-associated proteins like UbiB in the context of S. oneidensis' unique respiratory capabilities.

Co-immunoprecipitation (Co-IP) coupled with mass spectrometry represents a powerful approach, using antibodies against tagged UbiB protein to pull down protein complexes, followed by mass spectrometric analysis to identify interacting partners . This technique can reveal both stable and transient interactions within the electron transport chain components. For more targeted studies, bacterial two-hybrid systems can screen for specific protein-protein interactions between UbiB and other electron transport chain components.

Biophysical techniques such as surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC) provide quantitative measurements of binding affinities and kinetics between purified UbiB and potential interaction partners. Cross-linking mass spectrometry can capture transient interactions and provide spatial information about protein complexes involving UbiB and other respiratory proteins.

For Shewanella-specific applications, researchers must consider the unique components of its electron transport chain, particularly those involved in extracellular electron transfer . Recent advances in genetic manipulation of S. oneidensis, including a new recombineering system that allows precise genome editing, enable the creation of tagged versions of UbiB and other proteins for interaction studies . Correlating interaction studies with functional assays under various respiratory conditions (aerobic vs. anaerobic with different electron acceptors) provides the most comprehensive understanding of UbiB's role in S. oneidensis' distinctive electron transport processes.

How can genetic engineering approaches be used to study UbiB function in Shewanella oneidensis?

Genetic engineering approaches for studying UbiB function in Shewanella oneidensis have been significantly enhanced by recent methodological advances. These sophisticated techniques allow researchers to precisely manipulate the ubiB gene and study its function in detail.

Prophage-mediated genome engineering (recombineering) represents a breakthrough technique for S. oneidensis, utilizing a λ Red Beta homolog from Shewanella sp. W3-18-1 . This system allows precise genome editing with single-strand DNA oligonucleotides, enabling the creation of markerless mutations with approximately 5% efficiency among total cells . Researchers can use this approach to introduce point mutations, small insertions, or deletions that target specific functional domains of UbiB without disrupting the entire gene, allowing for nuanced analysis of structure-function relationships.

A recently developed robust electroporation method for S. oneidensis achieves high efficiency (~4.0 x 10^6 transformants/μg DNA), facilitating the introduction of various genetic constructs . This technique maintains high transformation efficiency even when cells are frozen for long-term storage, providing practical advantages for laboratory work . The availability of synthetic plasmid toolkits specifically designed for S. oneidensis MR-1 further enhances the genetic manipulation capabilities, allowing for fine-tuned expression of ubiB using various promoters and replicons .

These genetic tools can be combined with phenotypic assays measuring ubiquinone levels, respiratory capabilities with various electron acceptors, and growth under different conditions to comprehensively characterize UbiB function in S. oneidensis. The ability to make precise, markerless mutations represents a significant advancement over previous methods that relied on transposon mutagenesis and targeted knockouts using suicide vectors for gene disruptions .

What are the optimal conditions for expressing functional recombinant UbiB protein?

The optimal conditions for expressing functional recombinant Shewanella oneidensis UbiB protein involve careful consideration of expression systems, growth parameters, and purification strategies. Based on available research data, the following conditions have been found to be effective:

Expression System Parameters:

ParameterOptimal ConditionNotes
Host organismE. coliMost commonly used expression host
Expression vectorVectors with His-tagN-terminal His-tag facilitates purification
Protein lengthFull length (1-549 amino acids)Complete protein sequence ensures functionality

Culture and Purification Conditions:

ParameterOptimal ConditionNotes
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0Maintains protein stability
Storage temperature-20°C/-80°C for long-termAliquoting necessary for multiple use
Working storage4°C for up to one weekAvoids repeated freeze-thaw cycles
ReconstitutionDeionized sterile waterConcentration of 0.1-1.0 mg/mL recommended
Long-term preservation5-50% glycerol (final concentration)Default 50% glycerol recommended

The expression and purification strategy typically yields recombinant UbiB protein with greater than 90% purity as determined by SDS-PAGE . The protein requires careful handling to maintain its structural integrity and functional activity, with particular attention to avoiding repeated freeze-thaw cycles that can compromise protein stability .

For functional validation, researchers should consider including activity assays specific to UbiB's role in ubiquinone biosynthesis, potentially including kinase activity measurements if appropriate. These optimized conditions ensure the production of high-quality recombinant UbiB protein suitable for various research applications, including structural studies, enzymatic assays, and interaction analyses.

How can researchers assess the enzymatic activity of UbiB in relation to ubiquinone biosynthesis?

Assessing the enzymatic activity of UbiB in relation to ubiquinone biosynthesis requires specialized approaches due to the complex nature of the ubiquinone pathway and UbiB's probable role as a protein kinase. Researchers can implement several complementary methods to evaluate UbiB's functionality in the context of S. oneidensis' unique respiratory capabilities.

In vitro kinase activity assays represent a direct approach to assess UbiB function, measuring its ability to transfer phosphate groups to potential substrates in the ubiquinone biosynthesis pathway. This typically involves incubating purified recombinant UbiB protein with candidate substrate proteins or metabolic intermediates in the presence of ATP, followed by detection of phosphorylation using various analytical techniques.

Complementation studies provide a powerful genetic approach to assess UbiB functionality. This involves expressing S. oneidensis UbiB in ubiB mutant strains and evaluating whether it restores ubiquinone production and respiratory functions. With the development of precise genetic engineering tools for S. oneidensis, including prophage-mediated genome engineering and efficient electroporation methods , researchers can create clean ubiB knockout strains for such studies.

Ubiquinone quantification provides direct evidence of UbiB's role in the biosynthetic pathway. Techniques such as High-Performance Liquid Chromatography (HPLC) with electrochemical detection or Liquid Chromatography with tandem Mass Spectrometry (LC-MS/MS) can precisely measure ubiquinone levels in wild-type versus UbiB-modified strains. Extraction protocols typically involve lipid extraction using organic solvents, followed by separation and detection of ubiquinone and its precursors.

When designing these assays, researchers should consider S. oneidensis' respiratory versatility and adapt methods to account for potential differences in ubiquinone utilization under various electron acceptor conditions, particularly given the bacterium's ability to use metals, electrodes, and organic compounds as terminal electron acceptors .

What bioinformatic approaches are most useful for analyzing UbiB protein function and evolutionary relationships?

Bioinformatic approaches for analyzing UbiB protein function and evolutionary relationships in Shewanella oneidensis require a comprehensive toolset that integrates sequence, structural, and comparative genomic analyses. These computational methods provide valuable insights into UbiB's role in S. oneidensis' unique respiratory capabilities.

Multiple sequence alignment (MSA) represents a fundamental approach for identifying conserved domains and motifs across UbiB homologs from different bacterial species. Analysis of the 549-amino acid sequence of S. oneidensis UbiB reveals conservation patterns that can highlight functionally important residues. Profile hidden Markov models (HMMs) can further detect distant homology relationships, particularly useful given UbiB's classification as a "probable ubiquinone biosynthesis protein" .

Structural bioinformatics approaches are particularly valuable for understanding UbiB function. Homology modeling can predict UbiB's 3D structure based on related proteins, while molecular dynamics simulations can study protein flexibility and potential binding sites. These approaches are especially relevant given UbiB's probable role as a protein kinase in the ubiquinone biosynthesis pathway .

Comparative genomics provides a broader evolutionary context for understanding UbiB function. Synteny analysis examining the genomic context of ubiB (SO_4201) across Shewanella species and related genera can reveal co-evolutionary patterns with other components of the respiratory machinery. This is particularly relevant given S. oneidensis' ability to modulate expression of various respiratory components under different conditions, as demonstrated by RNA-Seq analysis showing coordinated expression of electron transport chain components under oxygen limitation .

Phylogenetic analysis using maximum likelihood or Bayesian inference methods can elucidate the evolutionary history of UbiB and its relationship to homologs in other bacteria. This approach can identify potential specialization of UbiB function in S. oneidensis related to its unique respiratory capabilities, particularly its ability to perform extracellular electron transfer .

What are the major challenges in studying UbiB function in Shewanella oneidensis and how can they be addressed?

The study of UbiB function in Shewanella oneidensis presents several significant challenges, each requiring specific methodological approaches to overcome. These challenges and their solutions represent important considerations for researchers investigating this protein's role in S. oneidensis' unique respiratory capabilities.

Table 1: Challenges and Solutions in Studying UbiB in S. oneidensis

ChallengeSolutionReference
Genetic manipulation limitationsProphage-mediated genome engineering (recombineering) using λ Red Beta homolog; robust electroporation method (~4.0 x 10^6 transformants/μg DNA)
Protein expression and purification difficultiesOptimized expression protocols with His-tagged constructs; storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0
Functional assay development complexityComplementary approaches combining biochemical assays with genetic studies; measurement of ubiquinone levels in wild-type versus mutant strains
Understanding context-dependent functionsRNA-Seq analysis under different respiratory conditions; comparing phenotypes across multiple electron acceptor conditions
Integration with extracellular electron transferCombined studies examining the relationship between ubiquinone biosynthesis and outer membrane cytochromes like MtrC and OmcA

Until recently, genetic manipulation of S. oneidensis was challenging due to limited genetic tools, with bacterial conjugation being the only reliable method for introducing DNA at high efficiency . The development of new techniques including prophage-mediated genome engineering and a robust electroporation method has significantly advanced the field, enabling markerless mutations and more sophisticated genetic studies of ubiB . These techniques achieve approximately 5% recombinants among total cells, representing a major improvement over previous methods .

Expression and purification of membrane-associated proteins like UbiB presents another significant challenge. Optimized protocols using E. coli expression systems with His-tagged constructs have been developed, with specific storage conditions (Tris/PBS-based buffer with 6% trehalose at pH 8.0) helping maintain protein stability . Avoiding repeated freeze-thaw cycles is crucial for maintaining protein function .

By addressing these challenges through integrated experimental approaches, researchers can develop a more comprehensive understanding of UbiB's role in S. oneidensis' remarkable respiratory versatility, particularly its ability to perform extracellular electron transfer under various environmental conditions.

How does UbiB protein contribute to Shewanella oneidensis' ability to perform extracellular electron transfer?

The contribution of UbiB protein to Shewanella oneidensis' extracellular electron transfer (EET) capabilities involves several interconnected mechanisms, though the relationship is complex and partially indirect. Understanding this connection requires examining UbiB's role in the context of S. oneidensis' unique respiratory adaptability.

As a probable ubiquinone biosynthesis protein , UbiB likely plays a critical role in maintaining adequate levels of ubiquinone, an essential lipid-soluble electron carrier in the respiratory chain. Ubiquinone serves as a central electron carrier in the inner membrane electron transport chain, facilitating electron flow from various dehydrogenases to terminal reductases. This establishes the electrochemical potential necessary for driving electrons through the Mtr pathway (involving MtrA, MtrB, and MtrC proteins) that ultimately enables extracellular electron transfer.

Research on S. oneidensis under electron acceptor limitation has shown coordinated expression of various respiratory components, including increased expression of heme biosynthesis pathways and cytochromes like MtrC and OmcA, which are essential for extracellular electron transfer . While specific data on UbiB expression under these conditions isn't directly provided in the search results, its role in ubiquinone biosynthesis suggests coordination with these pathways to maintain efficient electron flux.

S. oneidensis forms nanowires (extensions of its outer membrane containing cytochromes MtrC and OmcA) under oxygen-limited conditions . The ubiquinone pool, which UbiB helps maintain through its biosynthetic function, likely serves as an important electron reservoir during transitions between different respiratory modes, facilitating rapid adaptation to changing electron acceptor availability. Additionally, efficient extracellular electron transfer requires proper energy conservation mechanisms, where ubiquinone participates in proton-motive force generation essential for ATP synthesis.

Understanding UbiB's contribution to extracellular electron transfer has been facilitated by recent advances in genetic manipulation tools for S. oneidensis , allowing more precise investigation of the relationship between ubiquinone biosynthesis and the unique respiratory capabilities of this environmentally important bacterium.

What recent technological advances have improved our ability to study UbiB and similar proteins in Shewanella oneidensis?

Recent technological advances have significantly enhanced our ability to study UbiB and similar proteins in Shewanella oneidensis, spanning genetic manipulation, expression systems, and functional characterization methodologies. These advances have transformed researchers' capabilities to investigate the complex respiratory mechanisms of this environmentally important bacterium.

Advanced genetic engineering tools represent a major breakthrough in S. oneidensis research. A prophage-mediated genome engineering (recombineering) system using a λ Red Beta homolog from Shewanella sp. W3-18-1 enables precise genome editing with single-strand DNA oligonucleotides, achieving approximately 5% recombinants among total cells . This represents the first effective and simple strategy for recombination with markerless mutations in S. oneidensis . Additionally, a robust electroporation method achieving efficiency of ~4.0 x 10^6 transformants/μg DNA has overcome previous limitations in transformation efficiency .

The development of synthetic plasmid toolkits specifically designed for S. oneidensis MR-1 provides versatile options for gene expression studies . Previously, genetic manipulation was challenging due to limited genetic tools, with bacterial conjugation being the only reliable method for introducing DNA at high efficiency . These advances now allow researchers to precisely manipulate genes like ubiB to study their function in detail.

High-throughput transcriptomic approaches, particularly RNA-Seq analysis techniques, have been successfully applied to S. oneidensis to determine differential gene expression under varying conditions, such as oxygen limitation . These approaches allow researchers to place UbiB function in the context of broader cellular responses and identify co-regulated genes, particularly important given S. oneidensis' ability to form nanowires and increase cytochrome production during electron acceptor limitation .

Production of recombinant proteins from S. oneidensis has also advanced, with established protocols for expressing and purifying proteins like UbiB with high purity (>90%) using His-tagging and appropriate storage conditions (Tris/PBS-based buffer with 6% trehalose at pH 8.0) . These technological advances collectively enable more comprehensive characterization of UbiB's structure, function, and physiological context, advancing our understanding of its role in S. oneidensis' remarkable respiratory versatility.

How does UbiB protein structure and function compare between Shewanella oneidensis and other bacteria?

The UbiB protein structure and function show both conservation and divergence between Shewanella oneidensis and other bacteria, reflecting evolutionary adaptations to different ecological niches and respiratory strategies. This comparative understanding provides valuable insights into the specialized role of UbiB in S. oneidensis' unique respiratory capabilities.

This functional diversity may be reflected in regulatory differences, with S. oneidensis potentially showing different expression patterns of ubiB under various respiratory conditions compared to bacteria with more limited respiratory options. RNA-Seq analysis has revealed that S. oneidensis undergoes significant transcriptional reprogramming under oxygen-limited conditions, with coordinated increased expression of heme biosynthesis, cytochrome maturation, and transport pathways . While specific data on ubiB regulation is not provided in the search results, its function suggests integration with these respiratory adaptation mechanisms.

Understanding these comparative aspects of UbiB structure and function contributes to our knowledge of how S. oneidensis has evolved its remarkable ability to utilize diverse electron acceptors, a capability with significant implications for bioremediation and bioelectrochemical applications.

How is UbiB expression regulated in response to different environmental conditions in Shewanella oneidensis?

The regulation of UbiB expression in response to environmental conditions in Shewanella oneidensis involves complex mechanisms that allow the bacterium to adapt its respiratory capabilities to varying electron acceptor availability and redox conditions. While the search results don't provide direct data on ubiB regulation specifically, insights can be drawn from what is known about S. oneidensis' transcriptional responses to changing environments.

S. oneidensis undergoes significant transcriptional reprogramming under oxygen-limited conditions, as revealed by RNA-Seq analysis . Under these conditions, the bacterium increases expression of heme biosynthesis, cytochrome maturation, and transport pathways, including genes encoding MtrA, MtrC, and OmcA, which are essential for extracellular electron transfer . Given UbiB's role in ubiquinone biosynthesis, which is essential for both aerobic and anaerobic respiration in S. oneidensis, its expression is likely coordinated with these respiratory pathways.

Interestingly, not all respiratory components show the same expression patterns under oxygen limitation. The expression of mtrF and mtrD (homologs of mtrA and mtrC) either remains unaffected or decreases under these conditions , suggesting a functional specialization of different components of the electron transport machinery. This differential regulation indicates that S. oneidensis has evolved sophisticated regulatory mechanisms to optimize its respiratory apparatus for specific environmental conditions.

The development of new genetic tools for S. oneidensis, including prophage-mediated genome engineering and efficient electroporation methods , provides opportunities for more detailed investigation of ubiB regulation. These tools enable the construction of reporter gene fusions to study ubiB promoter activity under different growth conditions and the creation of precisely engineered mutants to investigate regulatory mechanisms.

Understanding UbiB regulation in the context of S. oneidensis' respiratory versatility has implications beyond basic science, as this bacterium's ability to adapt to diverse electron acceptors underlies its potential applications in bioremediation of toxic and radioactive metals and in bioelectrochemical systems .

What role does UbiB play in Shewanella oneidensis' stress response mechanisms?

The role of UbiB in Shewanella oneidensis' stress response mechanisms is multifaceted, involving both direct and indirect contributions to cellular resilience under various stress conditions. While the search results don't provide direct evidence for UbiB's role in stress response, its function in ubiquinone biosynthesis suggests significant involvement in maintaining cellular homeostasis during stress.

Ubiquinone, whose biosynthesis likely involves UbiB, acts as an antioxidant in bacterial membranes, scavenging reactive oxygen species and helping maintain redox homeostasis. This antioxidant function becomes particularly important during oxidative stress, which S. oneidensis may encounter in its natural environments or during transitions between aerobic and anaerobic respiration. Interestingly, S. oneidensis contains proteins like SYE4 (a member of the Old Yellow Enzyme family) that are induced under oxidative stress conditions for protection against oxidative damage . UbiB likely complements these dedicated oxidative stress response proteins by ensuring sufficient ubiquinone production during oxidative challenge.

During electron acceptor limitation, S. oneidensis undergoes significant transcriptional reprogramming, forms nanowires, and increases expression of cytochromes involved in extracellular electron transfer . UbiB's role in ubiquinone biosynthesis would be crucial during these transitions to maintain efficient electron flow through alternative respiratory pathways, alleviating stress caused by electron acceptor limitation.

S. oneidensis is known for its ability to reduce toxic metals, a process that can also protect the cell from metal toxicity. The efficient reduction of metals requires functional electron transport chains, in which ubiquinone plays a central role. UbiB likely contributes to metal stress tolerance by supporting the respiratory pathways involved in detoxification processes.

The recent development of advanced genetic tools for S. oneidensis, including precise genome editing techniques and high-efficiency transformation methods , opens new avenues for investigating UbiB's specific roles in stress response mechanisms. These tools enable the creation of defined ubiB mutants and the precise regulation of ubiB expression to determine its contribution to stress tolerance under various environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.