Recombinant Shewanella oneidensis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression in Shewanella oneidensis

While no studies directly report recombinant Lgt production in S. oneidensis, advances in genetic tools enable its feasibility:

  • Electroporation efficiency: ~4.0 × 10⁶ transformants/µg DNA, enabling plasmid-based expression .

  • Recombineering: A λ Red Beta homolog from Shewanella sp. W3-18-1 allows precise genome editing with 40–80 nt homology arms and ~5% recombination efficiency .

Key steps for recombinant Lgt production:

  1. Cloning: Subclone lgt into an arabinose-inducible plasmid (e.g., pBAD18s) with a His-tag for purification .

  2. Expression: Optimize induction in minimal media to avoid lipoprotein interference.

  3. Purification: Use nickel-affinity chromatography followed by size-exclusion chromatography .

Biotechnological Applications

Recombinant Lgt could enhance Shewanella's utility in:

  • Bioremediation: Engineered lipoproteins may improve metal reductase activity (e.g., MtrC/OmcA cytochromes) .

  • Biosensors: Lipoprotein-anchored redox probes for environmental monitoring .

  • Synthetic biology: Modular membrane protein design for bioelectrochemical systems .

Challenges and Future Directions

  • Post-translational regulation: Phosphorylation (e.g., at Ser42) may modulate Lgt activity under stress .

  • Host compatibility: Shewanella’s unique phospholipid composition (e.g., branched-chain fatty acids) could alter Lgt substrate specificity .

  • High-resolution structural data: Cryo-EM or crystallography is needed to resolve mechanistic details.

Table 2: Research Priorities for Recombinant Lgt in Shewanella

Priority AreaObjectiveMethodology
Structural characterizationResolve Lgt-phosphatidylglycerol bindingCryo-EM, X-ray crystallography
Activity profilingQuantify kinetics under varying pH/temperFluorescent lipid analogs
Metabolic engineeringOptimize lipoprotein yieldsCRISPR interference (CRISPRi)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
lgt; SO_1334; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Shewanella oneidensis (strain MR-1)
Target Names
lgt
Target Protein Sequence
MALNFPNIDPVIVKFGPFDIFGQTFEPALRWYGFTYLVGFVAAMWLLNRQADRSNGLWSR EQVSDLLFYGFLGVILGGRIGYVLFYHFDYFLASPMYLFKISEGGMSFHGGLIGVITAMI YITWKQKRTFFAVADMVAPVVPIGLGAGRIGNFINGELWGRVTDVPWAMVFPSGGPEPRH PSQLYQFALEGVALFLLLYWFSKRTKKVGAVSGMFLLGYGIFRVIVETVRQPDAQLGLYW GLMTMGQILSVPMILFGLYLILRPEGKQ
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: son:SO_1334

STRING: 211586.SO_1334

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is prolipoprotein diacylglyceryl transferase (Lgt) and what is its role in Shewanella oneidensis?

Prolipoprotein diacylglyceryl transferase (Lgt) is a membrane-bound enzyme that catalyzes the first step in bacterial lipoprotein biosynthesis by transferring an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine in the lipobox motif of prolipoproteins . This reaction results in the formation of a thioether-linked diacylglyceryl-prolipoprotein and glycerolphosphate as a by-product . In Shewanella oneidensis, Lgt plays a crucial role in the proper localization and function of lipoproteins that are involved in various cellular processes, including electron transfer pathways that are central to this organism's remarkable respiratory versatility .

The enzyme is part of a three-enzyme cascade in the lipoprotein modification pathway, followed by signal peptidase II (Lsp) and apolipoprotein N-acyltransferase (Lnt) . In electron-transferring bacteria like Shewanella oneidensis, proper processing of lipoproteins by Lgt is particularly important as many components of their extracellular electron transfer systems are lipoproteins or interact with lipoproteins at the cell surface or periplasmic space .

How is the Lgt gene structured in Shewanella species?

The Lgt gene in Shewanella species encodes a protein of approximately 268 amino acids, as indicated by the full-length sequence of Shewanella sp. strain ANA-3 . The amino acid sequence starts with "MALNFPNIDPVIVKFGP..." and continues with a predominantly hydrophobic composition reflecting its membrane-associated nature . Structural analyses suggest that Lgt contains multiple transmembrane domains that anchor it to the inner membrane, with catalytic domains positioned to access both the membrane phospholipids and the incoming prolipoproteins .

The gene organization around lgt in Shewanella genomes may differ from other bacteria, but the enzyme's core functional domains remain conserved across bacterial species. Comparative genomic analyses show that while Lgt is ubiquitous across bacteria, sequence variations exist that may reflect adaptation to different membrane compositions or environmental niches, which is particularly relevant for Shewanella species that inhabit diverse aquatic environments.

What is the substrate specificity of Shewanella Lgt compared to other bacterial species?

Substrate specificity of Lgt enzymes generally revolves around recognition of the lipobox motif in prolipoproteins, typically characterized by the consensus sequence [LVI][ASTVI][GAS]C, where the cysteine becomes the first amino acid of the mature lipoprotein after processing . For Shewanella Lgt, the enzyme must recognize this lipobox within the context of proteins that may be involved in electron transfer processes.

While the core catalytic mechanism appears conserved across bacterial species, subtle differences may exist in how efficiently different Lgt homologs process various prolipoprotein substrates. For instance, in comparison to E. coli Lgt, which has been extensively studied and shown to modify a wide range of prolipoproteins , Shewanella Lgt may possess adaptations that optimize its function for the specific suite of lipoproteins present in this organism, particularly those involved in metal reduction and electron transport chains .

Experimental evidence from biochemical assays suggests that bacterial Lgt enzymes can release both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) as by-products when using racemic phosphatidylglycerol substrates in vitro , though the natural preference may be more specific.

What are the optimal expression systems for recombinant Shewanella oneidensis Lgt?

The optimal expression of recombinant Shewanella oneidensis Lgt requires careful consideration of several factors due to its membrane-associated nature. Based on successful approaches with similar proteins, a recommended expression system would utilize E. coli BL21(DE3) or C43(DE3) strains specifically designed for membrane protein expression . The gene should be cloned into vectors containing inducible promoters like pET or pBAD series, with the addition of fusion tags such as His6, MBP, or c-myc for purification and detection purposes .

For better expression yields, lower induction temperatures (16-25°C) and reduced inducer concentrations are typically more effective than standard conditions. Additionally, supplementing the growth medium with appropriate phospholipids can help maintain the enzyme's native environment during expression. Co-expression with chaperones like GroEL/GroES may improve folding efficiency and yield of functional protein. When designing expression constructs, researchers should consider whether to include native signal sequences or replace them with E. coli-optimized versions to enhance membrane targeting.

What purification protocol yields the highest activity for recombinant Shewanella Lgt?

Purification of functional recombinant Shewanella Lgt presents challenges due to its multiple transmembrane domains. A successful protocol typically begins with careful cell lysis using either French press or sonication in buffer containing protease inhibitors and stabilizing agents . The membrane fraction isolation requires differential centrifugation followed by solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM), CHAPS, or digitonin at concentrations just above their critical micelle concentration .

For affinity purification, immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar matrices works effectively for His-tagged constructs. A two-step elution gradient (20-250 mM imidazole) often provides better separation from contaminants. Size exclusion chromatography as a polishing step helps remove aggregates and ensures a monodisperse protein preparation. Throughout purification, maintaining a detergent concentration above the critical micelle concentration is crucial for preserving enzyme activity. The purified enzyme should be stored in buffer containing glycerol (20-50%) and appropriate detergent at -20°C or -80°C for extended storage . Activity assays performed at each purification step can help track enzyme integrity.

How can researchers assess the quality and activity of purified recombinant Lgt?

Assessment of purified recombinant Lgt quality should begin with SDS-PAGE analysis to confirm purity and expected molecular weight, followed by Western blotting using anti-tag antibodies or Lgt-specific antibodies if available. Native PAGE or Blue Native PAGE can provide insights into the oligomeric state of the purified enzyme.

For activity assessment, researchers can utilize an in vitro assay that measures the release of glycerol phosphate, which is a by-product of the Lgt-catalyzed reaction . This assay typically involves incubating the purified enzyme with phosphatidylglycerol and a synthetic peptide substrate containing the lipobox motif (e.g., IAAC, where C is the conserved cysteine) . The released glycerol phosphate can be detected through coupled enzymatic reactions that produce a luminescent or colorimetric signal. A properly optimized assay should demonstrate linear kinetics with respect to both enzyme concentration and time, with clear dependence on both substrates.

Thermal shift assays can provide additional information about protein stability and proper folding. Circular dichroism spectroscopy may help confirm secondary structure elements expected for a properly folded membrane protein. Mass spectrometry analysis of the enzyme-substrate reaction products can provide definitive evidence of the diacylglyceryl transfer activity.

How does Lgt contribute to electron transfer mechanisms in Shewanella oneidensis?

In Shewanella oneidensis, Lgt plays an indirect but crucial role in extracellular electron transfer mechanisms by ensuring proper processing of lipoproteins involved in these pathways . Many components of the electron transfer chain, particularly those in the periplasmic space and outer membrane, require lipid modification for correct localization and function. Lgt catalyzes the first step in this modification process, attaching a diacylglyceryl group that serves as a membrane anchor.

Research suggests that certain c-type cytochromes, which are central to Shewanella's respiratory versatility, may interact with or depend on properly processed lipoproteins . For instance, studies with periplasmic cytochromes like PpcA and its homologs indicate complex interactions within the periplasmic electron transfer network, where lipoprotein components may serve as organizational scaffolds or facilitators . Experiments using electrode-grown biofilms of Shewanella mutants have demonstrated that defects in certain cytochrome pathways can be compensated by alternative routes, suggesting a robust and interconnected electron transfer network that depends on correctly processed membrane and periplasmic proteins .

What techniques are most effective for studying Lgt membrane topology in Shewanella?

Determining the membrane topology of Lgt in Shewanella can be accomplished through several complementary approaches. One effective strategy employs fusion proteins where portions of Lgt are fused to reporter enzymes like β-galactosidase (cytoplasmic reporter) and alkaline phosphatase (periplasmic reporter) . The activity patterns of these reporters in different fusion constructs can reveal which portions of the protein are exposed to either side of the membrane.

Another powerful approach is Substituted Cysteine Accessibility Method (SCAM) , which involves introducing cysteine residues at various positions throughout the protein and then determining their accessibility to membrane-impermeable sulfhydryl-reactive reagents. This technique can precisely map which portions of the protein are exposed to the aqueous environment on either side of the membrane.

Additional techniques include:

  • Protease protection assays using right-side-out and inside-out membrane vesicles

  • Site-directed spin labeling combined with electron paramagnetic resonance spectroscopy

  • Fluorescence resonance energy transfer (FRET) with strategically placed fluorophores

  • Cryo-electron microscopy of membrane-embedded protein

Integration of data from these various approaches can generate a comprehensive topological model of Lgt within the Shewanella inner membrane.

How can researchers develop effective inhibitors targeting Shewanella Lgt?

Development of effective Lgt inhibitors requires a systematic approach combining structural insights, biochemical assays, and medicinal chemistry. Starting with a robust in vitro assay measuring glycerol phosphate release , researchers can screen compound libraries to identify initial hits that inhibit the enzymatic activity. The assay should be optimized for high-throughput screening with appropriate positive controls.

Structure-based design approaches can leverage homology models based on available bacterial Lgt structures or directly use Shewanella Lgt structures if available. Computational docking studies can help identify potential binding modes of candidate inhibitors, with particular attention to the phosphatidylglycerol binding site and the catalytic region . Synthesized compounds should be tested for:

  • Potency against purified enzyme (IC50 determination)

  • Selectivity against mammalian enzymes

  • Antibacterial activity against whole cells

  • Mechanism validation using resistant mutants and biochemical assays

Recent research has identified the first Lgt inhibitors effective against E. coli and A. baumannii , suggesting that similar approaches could yield Shewanella-specific inhibitors. These compounds demonstrated potent inhibition of Lgt biochemical activity with IC50 values in the submicromolar range (0.18-0.93 μM) and showed bactericidal effects on wild-type strains. Unlike inhibitors of downstream lipoprotein processing pathways, Lgt inhibitors maintain efficacy even in strains lacking certain outer membrane lipoproteins, potentially reducing the risk of resistance development .

How does Shewanella oneidensis Lgt compare structurally and functionally to homologs in other bacteria?

Shewanella oneidensis Lgt shares core structural and functional features with homologs from other bacteria, but with distinct adaptations reflecting its ecological niche and metabolic capabilities. While the complete structure of Shewanella Lgt has not been fully determined, sequence analysis and experimental evidence suggest a multi-transmembrane domain protein anchored in the inner membrane, similar to E. coli Lgt .

The amino acid sequence of Shewanella sp. Lgt (strain ANA-3) comprises 268 amino acids with multiple hydrophobic regions consistent with transmembrane domains . Compared to the well-studied E. coli homolog, Shewanella Lgt likely maintains the conserved catalytic residues essential for diacylglyceryl transfer, including key aspartate residues that have been implicated in E. coli Lgt function through mutagenesis studies . Functional studies suggest that bacterial Lgt enzymes share a common catalytic mechanism involving formation of a thioether bond between the diacylglyceryl moiety and the conserved cysteine in the lipobox of prolipoproteins .

Notable differences may exist in substrate recognition patterns and regulatory mechanisms that reflect the specific lipoprotein complement in Shewanella, particularly those involved in its unusual respiratory diversity and metal reduction capabilities .

Can heterologous expression of Shewanella Lgt complement Lgt deficiency in other bacterial species?

Heterologous expression of Shewanella Lgt may potentially complement Lgt deficiency in other bacterial species, particularly those that are phylogenetically related or share similar membrane compositions. This approach offers valuable insights into the functional conservation and specificity of Lgt across species. Complementation studies typically involve expressing the Shewanella lgt gene in conditional lgt-depletion strains of model organisms like E. coli, under the control of inducible promoters.

A successful complementation would restore lipoprotein processing, membrane integrity, and growth in the depleted strain. The degree of functional restoration can be assessed through:

  • Growth curve analysis under depletion conditions

  • Detection of properly processed lipoproteins via Western blotting

  • Membrane permeability assays using dyes like propidium iodide

  • Resistance to serum killing and relevant antibiotics

  • Electron microscopy to evaluate membrane integrity

Partial complementation might indicate differences in substrate specificity or optimal enzymatic conditions between species. Experiments with Shewanella cytochromes expressed in other bacteria have shown that some proteins can be correctly targeted to the periplasm in heterologous hosts , suggesting that the lipoprotein processing machinery has sufficient cross-species compatibility to recognize and process some foreign substrates.

What evolutionary insights can be gained from studying Lgt across Shewanella species?

Studying Lgt across different Shewanella species offers valuable evolutionary insights into adaptation mechanisms for diverse ecological niches. Shewanella genus members occupy varied environments from deep sea to freshwater, with corresponding differences in respiratory capabilities, metal reduction potential, and membrane adaptations. Comparative genomics of Lgt across these species can reveal how this essential enzyme has evolved while maintaining its core function.

Sequence alignment analyses might identify:

  • Conserved catalytic domains indicating functional constraints

  • Variable regions potentially involved in species-specific substrate recognition

  • Adaptations correlating with environmental parameters (temperature, pressure, salinity)

  • Co-evolution patterns with lipoprotein partners specific to each species

The evolutionary trajectory of Lgt in Shewanella likely reflects the importance of membrane integrity and specialized electron transfer mechanisms in these bacteria. Unlike some other lipoprotein processing components that show variable distribution across bacterial taxa (e.g., Lnt being absent in many Gram-positive bacteria) , Lgt is universally conserved, highlighting its fundamental role in bacterial physiology. Comparing Lgt sequences between Shewanella species that differ in electron acceptor utilization capabilities could potentially link specific enzyme variations to differences in respiratory versatility.

What strategies can overcome low expression yields of recombinant Shewanella Lgt?

Low expression yields of recombinant Shewanella Lgt are a common challenge due to its membrane-associated nature. Researchers can implement several strategies to improve expression levels. First, codon optimization for the expression host can significantly enhance translation efficiency by eliminating rare codons present in the native Shewanella sequence. Using specialized E. coli strains like C41(DE3) or C43(DE3) that are engineered for membrane protein expression can also increase yields substantially.

Expression vector modifications can make a significant difference: adding a fusion partner like MBP (maltose-binding protein) or SUMO (small ubiquitin-like modifier) can enhance solubility, while optimizing the signal sequence for proper membrane targeting is crucial . Carefully controlling induction conditions is essential - lower induction temperatures (16-20°C), reduced IPTG concentrations (0.1-0.5 mM), and extended expression times (16-24 hours) often yield better results than standard conditions.

For particularly difficult constructs, cell-free expression systems may be considered as they bypass toxicity issues and can be supplemented with lipids to create a more native-like environment for the membrane protein. Alternatively, homologous expression in a closely related Shewanella species might preserve native folding conditions, though such systems typically have lower yields than optimized E. coli platforms.

How can researchers troubleshoot Lgt activity assays that show inconsistent results?

Inconsistent results in Lgt activity assays often stem from several common issues that can be systematically addressed. First, ensure enzyme stability throughout the assay by minimizing freeze-thaw cycles, maintaining appropriate detergent concentrations above critical micelle concentration, and including stabilizing agents like glycerol in storage buffers . The integrity of the phospholipid substrate is critical - phosphatidylglycerol can degrade during storage, so fresh preparation or validated commercial sources should be used .

The peptide substrate composition significantly impacts assay reliability. Using a synthetic peptide containing the consensus lipobox sequence (such as IAAC) ensures consistent substrate recognition . Control experiments should include a negative control with the conserved cysteine mutated to alanine (e.g., IAAA), which should show no activity .

Assay buffer composition requires optimization for Shewanella Lgt, as pH, ionic strength, and divalent cation concentrations can all affect enzyme activity. A methodical approach would test pH ranges (6.0-8.0) and various salt concentrations to determine optimal conditions. Detergent concentration is particularly critical - too little prevents substrate solubilization, while too much can denature the enzyme.

For detection systems measuring glycerol phosphate release, validate each component of the coupled enzyme system separately to ensure all reagents are functional . Incorporating internal standards and performing time course measurements can help identify non-linear kinetics that might indicate enzyme instability or substrate depletion.

What are effective approaches for studying structure-function relationships in Shewanella Lgt?

Studying structure-function relationships in Shewanella Lgt requires a multi-faceted approach combining molecular genetics, biochemistry, and structural biology techniques. Site-directed mutagenesis provides a powerful tool for systematically analyzing the roles of specific amino acids. Priority targets should include conserved residues identified through sequence alignments with well-characterized Lgt homologs, particularly focusing on aspartate residues that may participate in catalysis as seen in E. coli Lgt studies .

Each mutant should undergo comprehensive characterization:

  • Expression level and membrane localization assessment

  • In vitro activity assays measuring diacylglyceryl transfer

  • Substrate binding studies to distinguish between catalytic and binding defects

  • Complementation tests in conditional Lgt-depletion strains

For structural insights when crystallography proves challenging, alternative approaches include:

  • Hydrogen-deuterium exchange mass spectrometry to map solvent-accessible regions

  • Chemical cross-linking coupled with mass spectrometry to identify proximity relationships

  • Cryo-electron microscopy of membrane-embedded protein

  • Molecular dynamics simulations based on homology models

Studying truncation variants can help define minimal functional domains, while chimeric proteins created by domain swapping with Lgt from other species can illuminate substrate specificity determinants. The combination of these approaches can generate a comprehensive model linking specific structural features to functional roles in substrate recognition, membrane association, and catalytic activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.